PNMT Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33602

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PNMT Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit PNMT Antibody - BSA Free (NBP2-33602) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PNMT Antibody - BSA Free

Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602]

Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602]

Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602]

Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602]

Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human adrenal gland shows moderate to strong cytoplasmic positivity.
Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602]

Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602]

Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human adrenal gland, cerebral cortex, liver and pancreas using Anti-PNMT antibody NBP2-33602 (A) shows similar protein distribution across tissues to independent antibody NBP2-33392 (B).
Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602]

Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602]

Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602]

Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602]

Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602]

Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602]

Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining in human adrenal gland and pancreas tissues using NBP2-33602 antibody. Corresponding PNMT RNA-seq data are presented for the same tissues.

Applications for PNMT Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PNMT

The product of this gene catalyzes the last step of the catecholamine biosynthesis pathway, which methylates norepinephrine to form epinephrine (adrenaline). The enzyme also has beta-carboline 2N-methyltransferase activity. This gene is thought to play a key step in regulating epinephrine production.

Long Name

Phenylethanolamine N-Methyltransferase

Alternate Names

Noradrenaline N-methyltransferase, PENT, PNMTase

Gene Symbol

PNMT

UniProt

P11086

Additional PNMT Products

Product Documents for PNMT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PNMT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PNMT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PNMT Antibody - BSA Free and earn rewards!

Have you used PNMT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies