POLDIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80103

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all POLDIP1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human KCTD13. Peptide sequence PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for POLDIP1 Antibody - BSA Free

Western Blot: POLDIP1 Antibody [NBP1-80103]

Western Blot: POLDIP1 Antibody [NBP1-80103]

Western Blot: POLDIP1 Antibody [NBP1-80103] - Host: Rabbit. Target: KCTD13. Positive control (+): MCF7 Cell Lysate (N10). Negative control (-): Human Kidney (KI). Antibody concentration: 3ug/ml
Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP1-80103]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP1-80103]

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP1-80103] - Human Brain Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.
Western Blot: POLDIP1 Antibody [NBP1-80103]

Western Blot: POLDIP1 Antibody [NBP1-80103]

Western Blot: POLDIP1 Antibody [NBP1-80103] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Applications for POLDIP1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

4-8 ug/ml

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: POLDIP1

KCTD13 is a gene that codes for a widely expressed protein that functions as a substrate-specific adapter that is involved of the maintenance of the cytoskeleton structure via the regulation of the actin cytoskeleton and cell migrationt that is 329 amino acids long and weighs approximately 36 kDa. Studies are being conducted on diseases and disorders relating to this gene, including microephaly. KCTD13 has also been shown to have interactions with KAT7, LNX1, ZMYND19, ARMC7, and VTA1 in pathways such as the cholera infection, hepatic ABC transporter, PKA signaling, and sweet taste signaling pathways.

Alternate Names

BACURD1, BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1, BTB/POZ domain-containing protein KCTD13, hBACURD1, PDIP1FKSG86, POLDIP1TNFAIP1-like protein, Polymerase delta-interacting protein 1, potassium channel tetramerisation domain containing 13

Gene Symbol

KCTD13

UniProt

NP_849194 (Human)

Additional POLDIP1 Products

Product Documents for POLDIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for POLDIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for POLDIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review POLDIP1 Antibody - BSA Free and earn rewards!

Have you used POLDIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies