Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81852

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Predicted:

Rat (97%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Polypeptide GalNAc Transferase 1/GALNT1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:35087510).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free

Western Blot: Polypeptide GalNac Transferase 1/GALNT1 Antibody [NBP1-81852]

Western Blot: Polypeptide GalNac Transferase 1/GALNT1 Antibody [NBP1-81852]

Western Blot: Polypeptide GalNac Transferase 1/GALNT1 Antibody [NBP1-81852] - Analysis in human cell line RT-4.
Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free

Western Blot: Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free [NBP1-81852] -

GALNT7 protein expression, but not mRNA expression, is altered in CD4+ T cells following activation. (A) Model of GALNT1 and GALNT7 regulation by lncSnhg7. (B, C) CD4+CD25- T conventional cells were isolated from total splenocytes. Cells were cultured in the presence of anti-CD3/CD28 magnetic beads for 0 and 16 hours for RNA or 0 and 72 hours for protein. GALNT1 and GALNT7 expression was analyzed by qPCR (B) and western blot (C). Statistical significance was assessed using ratio paired t-tests between stimulated and unstimulated samples with correction for multiple comparisons using the Holm-Šidak method in post-hoc analysis. *p < 0.05. n = 3-7 per group. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35087510), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Polypeptide GalNAc Transferase 1/GALNT1

GALNT1 encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature. [provided by RefSeq]

Long Name

UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1

Alternate Names

GALNAC-T1, pp-GaNTase 1

Gene Symbol

GALNT1

Additional Polypeptide GalNAc Transferase 1/GALNT1 Products

Product Documents for Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Glycobiology-related Enzymes

Citations for Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free

Customer Reviews for Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free and earn rewards!

Have you used Polypeptide GalNac Transferase 1/GALNT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies