PPAN Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88525

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PPAN Antibody - BSA Free

PPAN Antibody - BSA Free Immunohistochemistry-Paraffin: PPAN Antibody - BSA Free [NBP1-88525]

Immunohistochemistry-Paraffin: PPAN Antibody - BSA Free [NBP1-88525]

Staining of human tonsil shows strong positivity in nucleoli in germinal and non-germinal center cells.
PPAN Antibody - BSA Free Immunohistochemistry-Paraffin: PPAN Antibody - BSA Free [NBP1-88525]

Immunohistochemistry-Paraffin: PPAN Antibody - BSA Free [NBP1-88525]

Staining of human colon shows moderate positivity in nucleoli in glandular cells.
PPAN Antibody - BSA Free Immunohistochemistry-Paraffin: PPAN Antibody - BSA Free [NBP1-88525]

Immunohistochemistry-Paraffin: PPAN Antibody - BSA Free [NBP1-88525]

Staining of human cervix shows strong positivity in nucleoli in squamous epithelial cells.
PPAN Antibody - BSA Free Immunohistochemistry-Paraffin: PPAN Antibody - BSA Free [NBP1-88525]

Immunohistochemistry-Paraffin: PPAN Antibody - BSA Free [NBP1-88525]

Staining of human cerebral cortex shows moderate positivity in nucleoli in neurons.
PPAN Antibody - BSA Free Western Blot: PPAN Antibody - BSA Free [NBP1-88525]

Western Blot: PPAN Antibody - BSA Free [NBP1-88525]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for PPAN Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PPAN

PPAN is encoded by this gene is an evolutionarily conserved protein similar to yeast SSF1 as well as to the gene product of the Drosophila gene peter pan (ppan). SSF1 is known to be involved in the second step of mRNA splicing. Both SSF1 and ppan are essential for cell growth and proliferation. This gene was found to cotranscript with P2RY11/P2Y(11), an immediate downstream gene on the chromosome that encodes a ATP receptor. The chimeric transcripts of this gene and P2RY11 were found to be ubiquitously present and regulated during granulocytic differentiation. Exogenous expression of this gene was reported to reduce the anchorage-independent growth of some tumor cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

Brix domain-containing protein 3, homolog of S. cerevisiae SSF1, MGC14226, MGC45852, peter pan (Drosophila) homolog, Peter Pan homolog, peter pan homolog (Drosophila), second-step splicing factor 1, SSF, Ssf-1, SSF1BXDC3SSF-1, SSF2, suppressor of sterile four 1, suppressor of SWI4 1 homolog

Gene Symbol

PPAN

Additional PPAN Products

Product Documents for PPAN Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PPAN Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PPAN Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PPAN Antibody - BSA Free and earn rewards!

Have you used PPAN Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...