PRDM9 Antibody (1H9Z1)

Novus Biologicals | Catalog # NBP3-35059

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Serum

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1H9Z1
View all PRDM9 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 87-370 of mouse PRDM9 (NP_659058.3).

Sequence:
DSEDSDEEWTPKQQVSPPWVPFRVKHSKQQKESSRMPFSGESNVKEGSGIENLLNTSGSEHVQKPVSSLEEGNTSGQHSGKKLKLRKKNVEVKMYRLRERKGLAYEEVSEPQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEYGQELGIKWG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PRDM9 Antibody (1H9Z1)

PRDM9 Antibody (1H9Z1)

Immunohistochemistry: PRDM9 Antibody (1H9Z1) [NBP3-35059] -

Immunohistochemistry: PRDM9 Antibody (1H9Z1) [NBP3-35059] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using PRDM9 Rabbit mAb at dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PRDM9 Antibody (1H9Z1)

Immunohistochemistry: PRDM9 Antibody (1H9Z1) [NBP3-35059] -

Immunohistochemistry: PRDM9 Antibody (1H9Z1) [NBP3-35059] - Immunohistochemistry analysis of paraffin-embedded Human colon using PRDM9 Rabbit mAb at dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
PRDM9 Antibody (1H9Z1)

Western Blot: PRDM9 Antibody (1H9Z1) [NBP3-35059] -

Western Blot: PRDM9 Antibody (1H9Z1) [NBP3-35059] - Western blot analysis of lysates from Rat kidney, using PRDM9 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
PRDM9 Antibody (1H9Z1)

Western Blot: PRDM9 Antibody (1H9Z1) [NBP3-35059] -

Western Blot: PRDM9 Antibody (1H9Z1) [NBP3-35059] - Western blot analysis of various lysates using PRDM9 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for PRDM9 Antibody (1H9Z1)

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:500 - 1:1000

Serum

CUT&Tag 105 cells /1 ug

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PRDM9

The PR domain is a protein-protein interaction module of about 100 amino acids. PR domain-containing proteins, such as PRDM9, are often involved in transcriptional regulation (Jiang and Huang, 2000 (PubMed 10668202)).(supplied by OMIM)

Long Name

Histone-lysine N-methyltransferase PRDM9

Alternate Names

EC 2.1.1.-, EC 2.1.1.354, EC 2.1.1.359, EC 2.1.1.361, EC 2.1.1.362, PFM6

Additional PRDM9 Products

Product Documents for PRDM9 Antibody (1H9Z1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PRDM9 Antibody (1H9Z1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PRDM9 Antibody (1H9Z1)

There are currently no reviews for this product. Be the first to review PRDM9 Antibody (1H9Z1) and earn rewards!

Have you used PRDM9 Antibody (1H9Z1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies