PRKAG3 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04525

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all AMPK gamma 3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PRKAG3 (NP_059127.2). MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PRKAG3 Antibody - Azide and BSA Free

Western Blot: PRKAG3 AntibodyAzide and BSA Free [NBP3-04525]

Western Blot: PRKAG3 AntibodyAzide and BSA Free [NBP3-04525]

Western Blot: PRKAG3 Antibody [NBP3-04525] - Western blot analysis of extracts of Mouse brain, using PRKAG3 antibody (NBP3-04525) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Western Blot: PRKAG3 AntibodyAzide and BSA Free [NBP3-04525]

Western Blot: PRKAG3 AntibodyAzide and BSA Free [NBP3-04525]

Western Blot: PRKAG3 Antibody [NBP3-04525] - Western blot analysis of extracts of Rat heart, using PRKAG3 antibody (NBP3-04525) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
PRKAG3 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: PRKAG3 Antibody - Azide and BSA Free [NBP3-04525] -

Immunocytochemistry/ Immunofluorescence: PRKAG3 Antibody - Azide and BSA Free [NBP3-04525] - Immunofluorescence analysis of RD cells using PRKAG3 Rabbit pAb (A14132) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for PRKAG3 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: AMPK gamma 3

PRKAG3 is encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit is one of the gamma regulatory subunits of AMPK. It is dominantly expressed in skeletal muscle. Studies of the pig counterpart suggest that this subunit may play a key role in the regulation of energy metabolism in skeletal muscle. [provided by RefSeq]

Long Name

AMP-activated Protein Kinase gamma 3

Alternate Names

AMPKG3, PRKAG3

Gene Symbol

PRKAG3

Additional AMPK gamma 3 Products

Product Documents for PRKAG3 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PRKAG3 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Autophagy
Intracellular Kinases
Obesity

Customer Reviews for PRKAG3 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PRKAG3 Antibody - Azide and BSA Free and earn rewards!

Have you used PRKAG3 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies