PSMB10/MECL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38155

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all PSMB10/MECL1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: FRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVT

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PSMB10/MECL1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PSMB10/MECL1 Antibody [NBP2-38155]

Immunocytochemistry/ Immunofluorescence: PSMB10/MECL1 Antibody [NBP2-38155]

Immunocytochemistry/Immunofluorescence: PSMB10/MECL1 Antibody [NBP2-38155] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP2-38155]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP2-38155]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP2-38155] - Staining in human lymph node and cerebral cortex tissues using anti-PSMB10 antibody. Corresponding PSMB10 RNA-seq data are presented for the same tissues.
Immunohistochemistry: PSMB10/MECL1 Antibody [NBP2-38155]

Immunohistochemistry: PSMB10/MECL1 Antibody [NBP2-38155]

Immunohistochemistry: PSMB10/MECL1 Antibody [NBP2-38155] - Staining of human tonsil shows nuclear positivity in non germinal center.
Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP2-38155]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP2-38155]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP2-38155] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP2-38155]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP2-38155]

Immunohistochemistry-Paraffin: PSMB10/MECL1 Antibody [NBP2-38155] - Staining of human lymph node shows high expression.

Applications for PSMB10/MECL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSMB10/MECL1

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Proteolytic processing is required to generate a mature subunit. Expression of this gene is induced by gamma interferon, and this gene product replaces catalytic subunit 2 (proteasome beta 7 subunit) in the immunoproteasome.

Long Name

Proteasome (Prosome, Macropain) Subunit, beta Type, 10

Alternate Names

LMP10, MECl-1, MECL1, Proteasome subunit beta-2i

Gene Symbol

PSMB10

UniProt

P40306 (Human)

Additional PSMB10/MECL1 Products

Product Documents for PSMB10/MECL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PSMB10/MECL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cell Cycle
T Cell Antigen Recognition

Customer Reviews for PSMB10/MECL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSMB10/MECL1 Antibody - BSA Free and earn rewards!

Have you used PSMB10/MECL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies