PSMC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35333

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human PSMC3 (NP_002799.3).

Sequence:
MEEGGRDKAPVQPQQSPAAAPGGTDEKPSGKERRDAGDKDKEQELSEEDKQLQDELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRPHYGKLKEIYENMAPGENKRFAADIISVLAMTMSGERECLKYRLVGSQEELASWGHEYVRHLAGEVAKEWQELDDAEKVQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PSMC3 Antibody - BSA Free

PSMC3 Antibody

Western Blot: PSMC3 Antibody [NBP3-35333] -

Western Blot: PSMC3 Antibody [NBP3-35333] - Western blot analysis of various lysates using PSMC3 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
PSMC3 Antibody

Immunocytochemistry/ Immunofluorescence: PSMC3 Antibody [NBP3-35333] -

Immunocytochemistry/ Immunofluorescence: PSMC3 Antibody [NBP3-35333] - Immunofluorescence analysis of U2OS cells using PSMC3 Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PSMC3 Antibody

Immunoprecipitation: PSMC3 Antibody [NBP3-35333] -

Immunoprecipitation: PSMC3 Antibody [NBP3-35333] - Immunoprecipitation analysis of 200 ug extracts of Jurkat cells, using 3 ug PSMC3 antibody. Western blot was performed from the immunoprecipitate using PSMC3 antibody at a dilution of 1:1000.

Applications for PSMC3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PSMC3

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases that have chaperone-like activity. This subunit may compete with PSMC2 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex. A pseudogene has been identified on chromosome 9. [provided by RefSeq]

Alternate Names

human immunodeficiency virus tat transactivator binding protein-1, MGC8487, proteasome (prosome, macropain) 26S subunit, ATPase, 3,26S proteasome AAA-ATPase subunit RPT5, Proteasome 26S subunit ATPase 3, Proteasome subunit P50, TBP-126S protease regulatory subunit 6A, TBP1Tat-binding protein 1

Gene Symbol

PSMC3

Additional PSMC3 Products

Product Documents for PSMC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSMC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PSMC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PSMC3 Antibody - BSA Free and earn rewards!

Have you used PSMC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...