PSP94 (prostate secretory protein of 94 amino acids; also named beta-MSP) is a secreted, non-glycosylated member of the beta-microseminoprotein family. The 94 amino acid (aa) mature PSP94 contains no classic motifs or domains, but does have ten Cys that are conserved across species. It is expressed in mucoid secretions, but its function is unknown. PSP94 is abundant in prostatic fluid, which is the exclusive source in rodents. Gastric and respiratory secretory epithelia are also significant sources in humans. Human PSP94 circulates bound to a 71 kDa PSP binding protein, possibly disulfide-linked. The seminal fluid protein CRISP-3 can also bind PSP94. PSP94 has been proposed as an alternative to PSA as a serum marker for prostate cancer. When total (bound plus free) PSP94 is considered, its secretion is found to be down-regulated in cancer cells, creating below normal circulating levels. Its size is predicted at 11 kDa, but may appear to be 16 kDa due to anomalous migration. A 61 aa variant, formed by C-terminal proteolysis, is increased in prostate secretions from patients with benign prostatic hyperplasia. A prostate-specific alternate splice form shows a substitution of 41 aa for the C-terminal 78 aa. Mature human PSP94 shares 53%, 46%, 43%, and 42% aa identity with porcine, rat, mouse, and chicken PSP94, respectively. Most of the ten primate sequences available show less than 80% aa identity. PSP94 has been proposed as a species barrier protein due to its low evolutionary conservation and abundance in seminal fluid.
PSP94/MSMB Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-33610
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit PSP94/MSMB Antibody - BSA Free (NBP2-33610) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for PSP94/MSMB Antibody - BSA Free
Western Blot: PSP94/MSMB Antibody [NBP2-33610]
Western Blot: PSP94/MSMB Antibody [NBP2-33610] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Prostate tissue
Immunohistochemistry-Paraffin: PSP94/MSMB Antibody [NBP2-33610]
Immunohistochemistry-Paraffin: PSP94/MSMB Antibody [NBP2-33610] - Staining of human endometrium shows low expression as expected.Immunohistochemistry-Paraffin: PSP94/MSMB Antibody [NBP2-33610]
Immunohistochemistry-Paraffin: PSP94/MSMB Antibody [NBP2-33610] - Staining of human prostate shows high expression.Applications for PSP94/MSMB Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: PSP94/MSMB
Long Name
Prostate Secretory Protein of 94 Amino Acids/Microseminoprotein, beta
Alternate Names
IGBF, MSMB, MSPB, PIP, PN44, PRPS, PSP57
Gene Symbol
MSMB
UniProt
Additional PSP94/MSMB Products
Product Documents for PSP94/MSMB Antibody - BSA Free
Product Specific Notices for PSP94/MSMB Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for PSP94/MSMB Antibody - BSA Free
There are currently no reviews for this product. Be the first to review PSP94/MSMB Antibody - BSA Free and earn rewards!
Have you used PSP94/MSMB Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...