PSPC1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93111

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PSPC1 (NP_001035879.1). MMLRGNLKQVRIEKNPARLRALESAVGESEPAAAAAMALALAGEPAPPAPAPPEDHPDEEMGFTIDIKSF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PSPC1 Antibody - Azide and BSA Free

Western Blot: PSPC1 AntibodyAzide and BSA Free [NBP2-93111]

Western Blot: PSPC1 AntibodyAzide and BSA Free [NBP2-93111]

Western Blot: PSPC1 Antibody [NBP2-93111] - Analysis of 200ug extracts of A-549 cells using PSPC1 at a dilition of 1:1000.
Immunohistochemistry-Paraffin: PSPC1 Antibody - Azide and BSA Free [NBP2-93111]

Immunohistochemistry-Paraffin: PSPC1 Antibody - Azide and BSA Free [NBP2-93111]

Immunohistochemistry-Paraffin: PSPC1 Antibody [NBP2-93111] - Immunohistochemistry of paraffin-embedded Human esophageal using PSPC1 Rabbit pAb (NBP2-93111) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Western Blot: PSPC1 AntibodyAzide and BSA Free [NBP2-93111]

Western Blot: PSPC1 AntibodyAzide and BSA Free [NBP2-93111]

Western Blot: PSPC1 Antibody [NBP2-93111] - Analysis of extracts of various cell lines, using PSPC1 at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: PSPC1 Antibody - Azide and BSA Free [NBP2-93111]

Immunohistochemistry-Paraffin: PSPC1 Antibody - Azide and BSA Free [NBP2-93111]

Immunohistochemistry-Paraffin: PSPC1 Antibody [NBP2-93111] - Immunohistochemistry of paraffin-embedded Mouse testis using PSPC1 Rabbit pAb (NBP2-93111) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: PSPC1 Antibody - Azide and BSA Free [NBP2-93111]

Immunohistochemistry-Paraffin: PSPC1 Antibody - Azide and BSA Free [NBP2-93111]

Immunohistochemistry-Paraffin: PSPC1 Antibody [NBP2-93111] - Immunohistochemistry of paraffin-embedded Rat brain using PSPC1 Rabbit pAb (NBP2-93111) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for PSPC1 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50-1:200

Immunoprecipitation

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PSPC1

Regulates, cooperatively with NONO and SFPQ, androgen receptor-mediated gene transcription activity in Sertoli cell line. Binds to poly(A), poly(G) and poly(U) RNA homopolymers

Alternate Names

FLJ33554, paraspeckle component 1, paraspeckle protein 1, PSP1

Gene Symbol

PSPC1

Additional PSPC1 Products

Product Documents for PSPC1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PSPC1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for PSPC1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review PSPC1 Antibody - Azide and BSA Free and earn rewards!

Have you used PSPC1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...