PTBP1 Antibody (9M6A8)

Novus Biologicals | Catalog # NBP3-16197

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9M6A8 expressed in HEK293
View all PTBP1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTBP1 (P26599). MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PTBP1 Antibody (9M6A8)

Western Blot: PTBP1 Antibody (9M6A8) [NBP3-16197]

Western Blot: PTBP1 Antibody (9M6A8) [NBP3-16197]

Western Blot: PTBP1 Antibody (9M6A8) [NBP3-16197] - Western blot analysis of extracts of various cell lines, using PTBP1 Rabbit mAb (NBP3-16197) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: PTBP1 Antibody (9M6A8) [NBP3-16197]

Immunocytochemistry/ Immunofluorescence: PTBP1 Antibody (9M6A8) [NBP3-16197]

Immunocytochemistry/Immunofluorescence: PTBP1 Antibody (9M6A8) [NBP3-16197] - Immunofluorescence analysis of U-2 OS cells using PTBP1 Rabbit mAb (NBP3-16197) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: PTBP1 Antibody (9M6A8) [NBP3-16197]

Immunocytochemistry/ Immunofluorescence: PTBP1 Antibody (9M6A8) [NBP3-16197]

Immunocytochemistry/Immunofluorescence: PTBP1 Antibody (9M6A8) [NBP3-16197] - Immunofluorescence analysis of NIH-3T3 cells using PTBP1 Rabbit mAb (NBP3-16197) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
PTBP1 Antibody (9M6A8)

Immunohistochemistry: PTBP1 Antibody (9M6A8) [NBP3-16197] -

Immunohistochemistry: PTBP1 Antibody (9M6A8) [NBP3-16197] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using PTBP1 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
PTBP1 Antibody (9M6A8)

Immunohistochemistry: PTBP1 Antibody (9M6A8) [NBP3-16197] -

Immunohistochemistry: PTBP1 Antibody (9M6A8) [NBP3-16197] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using PTBP1 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for PTBP1 Antibody (9M6A8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PTBP1

PTBP1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

Heterogeneous nuclear ribonucleoprotein I, heterogeneous nuclear ribonucleoprotein polypeptide I, hnRNP I, HNRNPI, HNRNP-I, HNRPI, MGC10830, MGC8461, polypyrimidine tract binding protein (heterogeneous nuclear ribonucleoproteinI), polypyrimidine tract binding protein 1, polypyrimidine tract-binding protein 1, pPTB, PTB-1, PTB2, PTB3, PTB4, PTB57 kDa RNA-binding protein PPTB-1, PTB-T, RNA-binding protein

Gene Symbol

PTBP1

Additional PTBP1 Products

Product Documents for PTBP1 Antibody (9M6A8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for PTBP1 Antibody (9M6A8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PTBP1 Antibody (9M6A8)

There are currently no reviews for this product. Be the first to review PTBP1 Antibody (9M6A8) and earn rewards!

Have you used PTBP1 Antibody (9M6A8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies