PTGER3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84835

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVS

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23227994)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PTGER3 Antibody - BSA Free

PTGER3 Antibody - BSA Free Immunohistochemistry-Paraffin: PTGER3 Antibody - BSA Free [NBP1-84835]

Immunohistochemistry-Paraffin: PTGER3 Antibody - BSA Free [NBP1-84835]

Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Applications for PTGER3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTGER3

Prostaglandin E Receptor EP3 is a member of the G protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli. Prostaglandin E2 Receptor EP3 expression has been documented throughout the periphery, especially kidney. ESTs have been isolated primarily from kidney libraries.

Long Name

Prostaglandin E2 Receptor 3, Subtype EP3

Alternate Names

EP3

Gene Symbol

PTGER3

Additional PTGER3 Products

Product Documents for PTGER3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PTGER3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PTGER3 Antibody - BSA Free

Customer Reviews for PTGER3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PTGER3 Antibody - BSA Free and earn rewards!

Have you used PTGER3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PTGER3 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I received an e-mail about some complimentary antibody samples that are available. We work with Ptger3 and have tried several antibodies (Santa Cruz, Abcam, Cayman) but haven't found an antibody that works. I was wondering if you would be willing to send us a complimentary sample of your Ptger3 antibody to test? If it works, we will likely buy a decent amount.

    A: A list of our Ptger3 antibodies can be found here. It is company policy that we do not give out free samples as we have a 100% guarantee on all of our products for the applications and species listed on the datasheet. The email you received about free samples only applies to the antibodies listed in the email, of which Ptger3 is not listed.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...