PTOV1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79384

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human PTOV1The immunogen for this antibody is PTOV1. Peptide sequence DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PTOV1 Antibody - BSA Free

Western Blot: PTOV1 Antibody [NBP1-79384]

Western Blot: PTOV1 Antibody [NBP1-79384]

Western Blot: PTOV1 Antibody [NBP1-79384] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: PTOV1 Antibody [NBP1-79384]

Immunohistochemistry: PTOV1 Antibody [NBP1-79384]

Immunohistochemistry: PTOV1 Antibody [NBP1-79384] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytes and processes of intersticial cells Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: PTOV1 Antibody [NBP1-79384]

Western Blot: PTOV1 Antibody [NBP1-79384]

Western Blot: PTOV1 Antibody [NBP1-79384] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: PTOV1 Antibody [NBP1-79384]

Western Blot: PTOV1 Antibody [NBP1-79384]

Western Blot: PTOV1 Antibody [NBP1-79384] - Analysis of 721_B whole cell lysates, Antibody Dilution: 0.5 ug/ml.
Western Blot: PTOV1 Antibody [NBP1-79384]

Western Blot: PTOV1 Antibody [NBP1-79384]

Western Blot: PTOV1 Antibody [NBP1-79384] - Jurkat Whole Cell lysates, Antibody Dilution: 0.5 ug/ml.

Applications for PTOV1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTOV1

PTOV1 may activate transcription. Required for nuclear translocation of FLOT1. Promotes cell proliferation

Alternate Names

ACID2, Activator interaction domain-containing protein 2, DKFZp586I111, MGC71475, prostate tumor overexpressed 1, prostate tumor overexpressed gene 1, PTOV-1

Gene Symbol

PTOV1

Additional PTOV1 Products

Product Documents for PTOV1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PTOV1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PTOV1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PTOV1 Antibody - BSA Free and earn rewards!

Have you used PTOV1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...