PTPRK Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30977

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAESSRLLDVPRYLCE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PTPRK Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PTPRK Antibody [NBP2-30977]

Immunocytochemistry/ Immunofluorescence: PTPRK Antibody [NBP2-30977]

Immunocytochemistry/Immunofluorescence: PTPRK Antibody [NBP2-30977] - Staining of human cell line SiHa shows localization to plasma membrane & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977]

Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977]

Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977] - Staining of human prostate shows moderate positivity in apical membranes in glandular cells.
Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977]

Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977]

Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977] - Staining of human cerebral cortex shows moderate positivity in a subset of neural fibers.
Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977]

Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977]

Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977] - Staining of human endometrium shows moderate positivity in apical membranes in glandular cells.
Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977]

Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977]

Immunohistochemistry-Paraffin: PTPRK Antibody [NBP2-30977] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.

Applications for PTPRK Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PTPRK

PTP kappa (PTPRK)is a member of the protein tyrosine phosphatase (PTP) family. The family comprises at least 37 proteins, characterized by a catalytic phosphatase domain of approximately 240 amino acids, and includes both transmembrane and cytosolic enzymes. PTP kappa is c-transmembrane PTP. The PTPs have high substrate specificity for phosphotyrosyl proteins and, at the primary sequence level, share little similarity with the protein serine phosphatases, protein threonine phosphatases, or the acid and alkaline phosphatases. PTP kappa is involved in the regulation of processes involving cell contact and adhesion, tumour invasion and metastasis. Regulation of processes involving cell contact and adhesion such as growth control. tumor invasion. and metastasis. Forms complexes with beta-catenin and gamma-catenin/plakoglobin. Beta-catenin may be a substrate for the catalytic activity of PTP-kappa.

Alternate Names

DKFZp686C2268, DKFZp779N1045, EC 3.1.3.48, protein tyrosine phosphatase kappa, protein tyrosine phosphatase kappa, protein tyrosine phosphatase, receptor type, K, Protein-tyrosine phosphatase kappa, protein-tyrosine phosphatase, receptor type, kappa, PTPK, receptor type, K (R-PTP-KAPPA, receptor-type tyrosine-protein phosphatase kappa

Gene Symbol

PTPRK

UniProt

Additional PTPRK Products

Product Documents for PTPRK Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PTPRK Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for PTPRK Antibody - BSA Free

Customer Reviews for PTPRK Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PTPRK Antibody - BSA Free and earn rewards!

Have you used PTPRK Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...