PUF60 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57501

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to PUF60(poly-U binding splicing factor 60KDa) The peptide sequence was selected from the C terminal of PUF60. Peptide sequence EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for PUF60 Antibody - BSA Free

Western Blot: PUF60 Antibody [NBP1-57501]

Western Blot: PUF60 Antibody [NBP1-57501]

Western Blot: PUF60 Antibody [NBP1-57501] - Antibody Titration: 0.2-1 ug/ml Positive control: HelaPUF60 is supported by BioGPS gene expression data to be expressed in HeLa.
Immunohistochemistry: PUF60 Antibody [NBP1-57501]

Immunohistochemistry: PUF60 Antibody [NBP1-57501]

Immunohistochemistry: PUF60 Antibody [NBP1-57501]
Western Blot: PUF60 Antibody [NBP1-57501]

Western Blot: PUF60 Antibody [NBP1-57501]

Western Blot: PUF60 Antibody [NBP1-57501] - Transfected 293T Cell Lysate 5ug/ml Gel Concentration 12%
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP1-57501]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP1-57501]

Immunohistochemistry-Paraffin: PUF60 Antibody [NBP1-57501] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.

Applications for PUF60 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PUF60

PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription.The protein encoded by this gene is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. This gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for this gene.

Alternate Names

FBP interacting repressor, FBP-interacting repressor, FIRpoly-U binding splicing factor PUF60, FLJ31379, FUSE-binding protein-interacting repressor, poly(U)-binding-splicing factor PUF60, poly-U binding splicing factor 60KDa, Ro ribonucleoprotein binding protein 1, Ro ribonucleoprotein-binding protein 1, Ro-binding protein 1, roBP1, ROBPI, siah binding protein 1,60 kDa poly(U)-binding-splicing factor, Siah-binding protein 1, Siah-BP1, SIAHBP1pyrimidine tract binding splicing factor

Gene Symbol

PUF60

Additional PUF60 Products

Product Documents for PUF60 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PUF60 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PUF60 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PUF60 Antibody - BSA Free and earn rewards!

Have you used PUF60 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...