PUM2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89623

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ASPTEVVERLGPNTNPSEGLGPLPNPTANKPLVEEFSNPETQNLDAMEQVGLESLQF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for PUM2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PUM2 Antibody [NBP1-89623]

Immunocytochemistry/ Immunofluorescence: PUM2 Antibody [NBP1-89623]

Immunocytochemistry/Immunofluorescence: PUM2 Antibody [NBP1-89623] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
PUM2 Antibody - BSA Free Immunohistochemistry-Paraffin: PUM2 Antibody - BSA Free [NBP1-89623]

Immunohistochemistry-Paraffin: PUM2 Antibody - BSA Free [NBP1-89623]

Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
PUM2 Antibody - BSA Free Immunohistochemistry-Paraffin: PUM2 Antibody - BSA Free [NBP1-89623]

Immunohistochemistry-Paraffin: PUM2 Antibody - BSA Free [NBP1-89623]

Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
PUM2 Antibody - BSA Free Immunohistochemistry-Paraffin: PUM2 Antibody - BSA Free [NBP1-89623]

Immunohistochemistry-Paraffin: PUM2 Antibody - BSA Free [NBP1-89623]

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
PUM2 Antibody - BSA Free Immunohistochemistry-Paraffin: PUM2 Antibody - BSA Free [NBP1-89623]

Immunohistochemistry-Paraffin: PUM2 Antibody - BSA Free [NBP1-89623]

Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.
PUM2 Antibody - BSA Free Western Blot: PUM2 Antibody - BSA Free [NBP1-89623]

Western Blot: PUM2 Antibody - BSA Free [NBP1-89623]

Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Applications for PUM2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PUM2

Pumilio 2 is a component of conserved cellular machinery required for germ cell development, Pum2 is a human homolog of Pumilio, which helps maintain germ line stem cells in Drosophila and C. elegans. Pum2 forms a stable complex with DAZ through the same functional domain required for RNA binding and protein-protein interactions. Pum2 is expressed predominantly in human embryonic stem cells and germ cells and colocalizes with DAZ and DAZL in germ cells.

Long Name

Pumilio 2

Alternate Names

PUMH2, Pumilio-2, PUML2

Gene Symbol

PUM2

Additional PUM2 Products

Product Documents for PUM2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for PUM2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for PUM2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review PUM2 Antibody - BSA Free and earn rewards!

Have you used PUM2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...