Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8)

Novus Biologicals | Catalog # NBP3-16720

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5T6S8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 337-436 of human Pyruvate Dehydrogenase Kinase 1/PDK1 (NP_002601.1). STAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8)

Western Blot: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8) [NBP3-16720]

Western Blot: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8) [NBP3-16720]

Western Blot: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (9A7X4) [NBP3-16720] - Western blot analysis of extracts of various cell lines, using Pyruvate Dehydrogenase Kinase 1/PDK1/PDHK1 Rabbit mAb (NBP3-16720) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8)

Western Blot: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8) [NBP3-16720] -

Western Blot: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8) [NBP3-16720] - Western blot analysis of various lysates, using Pyruvate Dehydrogenase Kinase 1/PDK1 Rabbit mAb at 1:20000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8)

Immunohistochemistry: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8) [NBP3-16720] -

Immunohistochemistry: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8) [NBP3-16720] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using Pyruvate Dehydrogenase Kinase 1/PDK1 Rabbit mAb at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8)

Application
Recommended Usage

Immunohistochemistry

1:100 - 1:500

Immunohistochemistry-Paraffin

1:100 - 1:500

Western Blot

1:2000 - 1:10000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Pyruvate Dehydrogenase Kinase 1/PDK1

Pyruvate dehydrogenase kinase isoform 1 (PDK1) is a component of the mitochondrial multienzyme complex (PHD) which is responsible for carbohydrate fuel regulation. PDK1 inhbits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

PDK1 antibodies are useful tools for glucose metabolism research and mitochondrial metabolism studies.

Alternate Names

EC 2.7.11, EC 2.7.11.2, mitochondrial pyruvate dehydrogenase, lipoamide, kinase isoenzyme 1, PDH kinase 1, PDK1, PDK-1, PKB kinase, Pyruvate dehydrogenase kinase isoform 1, pyruvate dehydrogenase kinase, isoenzyme 1, pyruvate dehydrogenase kinase, isozyme 1, Pyruvate dehydrogenase lipoamide kinase isozyme 1, mitochondrial

Gene Symbol

PDK1

Additional Pyruvate Dehydrogenase Kinase 1/PDK1 Products

Product Documents for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8)

There are currently no reviews for this product. Be the first to review Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8) and earn rewards!

Have you used Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (5T6S8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...