QSOX1/Quiescin Q6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55409

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all QSOX1/Quiescin Q6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CSACHNERLDVPVWDVEATLNFLKAHFSPSNIILDFPAAGSAARRDVQNVAAAPELAMGALELESRNSTLDP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for QSOX1/Quiescin Q6 Antibody - BSA Free

Western Blot: QSOX1/Quiescin Q6 Antibody [NBP2-55409]

Western Blot: QSOX1/Quiescin Q6 Antibody [NBP2-55409]

Western Blot: QSOX1/Quiescin Q6 Antibody [NBP2-55409] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: QSOX1/Quiescin Q6 Antibody [NBP2-55409]

Immunocytochemistry/ Immunofluorescence: QSOX1/Quiescin Q6 Antibody [NBP2-55409]

Immunocytochemistry/Immunofluorescence: QSOX1/Quiescin Q6 Antibody [NBP2-55409] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.
Western Blot: QSOX1/Quiescin Q6 Antibody [NBP2-55409]

Western Blot: QSOX1/Quiescin Q6 Antibody [NBP2-55409]

Western Blot: QSOX1/Quiescin Q6 Antibody [NBP2-55409] - Analysis in human cell line U-251 MG.

Applications for QSOX1/Quiescin Q6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: QSOX1/Quiescin Q6

Quiescin Q6, also known as Sulfhydryl oxidase 1, is a 83 kDa 747 amino acid protein with a shorter 67 kDa 604 isoform. The primary function of Quiescin Q6 is to regulate growth. Current research on Quiescin Q6 is being conducted in relation to intrahepatic cholangiocarcinoma, insulin resistance, cholangiocarcinoma, prostate cancer, prostatitis, breast cancer and ataxia.

Long Name

Quiescin Q6 Sulfhydryl Oxidase 1

Alternate Names

HQSOX, QSCN6, Quiescin Q6, Sulfhydryl Oxidase-1

Gene Symbol

QSOX1

Additional QSOX1/Quiescin Q6 Products

Product Documents for QSOX1/Quiescin Q6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for QSOX1/Quiescin Q6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Oxidases and Oxygenases
Redox Enzymes

Customer Reviews for QSOX1/Quiescin Q6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review QSOX1/Quiescin Q6 Antibody - BSA Free and earn rewards!

Have you used QSOX1/Quiescin Q6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies