Rab20 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35781

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Rab20 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 80-190 of human Rab20 (NP_060287.1).

Sequence:
YDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Rab20 Antibody - BSA Free

Rab20 Antibody

Immunocytochemistry/ Immunofluorescence: Rab20 Antibody [NBP3-35781] -

Immunocytochemistry/ Immunofluorescence: Rab20 Antibody [NBP3-35781] - Immunofluorescence analysis of L929 cells using Rab20 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Rab20 Antibody

Western Blot: Rab20 Antibody [NBP3-35781] -

Western Blot: Rab20 Antibody [NBP3-35781] - Western blot analysis of lysates from Mouse heart, using Rab20 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 15s.

Applications for Rab20 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Rab20

RAB20, also known as Ras-related protein Rab-20, is a 234 amino acid protein that is 26 kDa, belongs to the small GTPase superfamily, expressed in 15 of 18 exocrine pancreatic adenocarcinomas, plays a role in apical endocytosis/recycling, maturation and acidification of phagosomes that engulf pathogens such as S.aureus and M.tuberculosis, and in the fusion of phagosomes with lysosomes. This protein is currently being studied for its involvement in hemophagocytic lymphohistiocytosis, pancreatic carcinoma, pancreatitis, adenocarcinoma, and carcinoma. RAB20 protein has interactions with SMURF1, SMAD4 and TGFBR1 in Epithelial Tight Junctions pathway.

Alternate Names

FLJ20429, RAB20, member RAS oncogene family, ras-related protein Rab-20

Gene Symbol

RAB20

Additional Rab20 Products

Product Documents for Rab20 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Rab20 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rab20 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rab20 Antibody - BSA Free and earn rewards!

Have you used Rab20 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies