RAB23 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86366

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RAB23 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RAB23 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RAB23 Antibody [NBP1-86366]

Immunocytochemistry/ Immunofluorescence: RAB23 Antibody [NBP1-86366]

Immunocytochemistry/Immunofluorescence: RAB23 Antibody [NBP1-86366] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol and centrosome.
RAB23 Antibody - BSA Free Western Blot: RAB23 Antibody - BSA Free [NBP1-86366]

Western Blot: RAB23 Antibody - BSA Free [NBP1-86366]

Analysis in control (vector only transfected HEK293T lysate) and RAB23 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: RAB23 Antibody [NBP1-86366]

Immunohistochemistry-Paraffin: RAB23 Antibody [NBP1-86366]

Immunohistochemistry-Paraffin: RAB23 Antibody [NBP1-86366] - Staining of human skeletal muscle shows low expression as expected.
RAB23 Antibody - BSA Free Immunohistochemistry-Paraffin: RAB23 Antibody - BSA Free [NBP1-86366]

Immunohistochemistry-Paraffin: RAB23 Antibody - BSA Free [NBP1-86366]

Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
RAB23 Antibody - BSA Free Immunohistochemistry-Paraffin: RAB23 Antibody - BSA Free [NBP1-86366]

Immunohistochemistry-Paraffin: RAB23 Antibody - BSA Free [NBP1-86366]

Analysis in human prostate and skeletal muscle tissues Corresponding RAB23 RNA-seq data are presented for the same tissues.
RAB23 Antibody - BSA Free Immunohistochemistry-Paraffin: RAB23 Antibody - BSA Free [NBP1-86366]

Immunohistochemistry-Paraffin: RAB23 Antibody - BSA Free [NBP1-86366]

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
RAB23 Antibody - BSA Free Immunohistochemistry-Paraffin: RAB23 Antibody - BSA Free [NBP1-86366]

Immunohistochemistry-Paraffin: RAB23 Antibody - BSA Free [NBP1-86366]

Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Applications for RAB23 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAB23

RAB23 is encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Alternate Names

DKFZp781H0695, HSPC137, MGC8900, RAB family small GTP binding protein RAB 23, RAB23, member RAS oncogene family, ras-related protein Rab-23

Gene Symbol

RAB23

Additional RAB23 Products

Product Documents for RAB23 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RAB23 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAB23 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAB23 Antibody - BSA Free and earn rewards!

Have you used RAB23 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies