RAD54B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58233

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RAD54B Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to RAD54B(RAD54 homolog B (S. cerevisiae)) The peptide sequence was selected from the N terminal of RAD54B. Peptide sequence DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RAD54B Antibody - BSA Free

Western Blot: RAD54B Antibody [NBP1-58233]

Western Blot: RAD54B Antibody [NBP1-58233]

Western Blot: RAD54B Antibody [NBP1-58233] - Human Brain lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry-Paraffin: RAD54B Antibody [NBP1-58233] -

Immunohistochemistry-Paraffin: RAD54B Antibody [NBP1-58233] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Nuclear in hepatocytes, very strong signal, wide tissue distribution

Applications for RAD54B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAD54B

RAD54B belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.

Alternate Names

DNA repair and recombination protein RAD54B, EC 3.6.1, EC 3.6.4.-, fibrinogen silencer binding protein, FSBP, RAD54 homolog B, RAD54 homolog B (S. cerevisiae), RDH54

Gene Symbol

RAD54B

UniProt

Q9Y620 (Human)

Additional RAD54B Products

Product Documents for RAD54B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RAD54B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAD54B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAD54B Antibody - BSA Free and earn rewards!

Have you used RAD54B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies