RalA/RalB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79633

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human RALAThe immunogen for this antibody is RALA. Peptide sequence GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RalA/RalB Antibody - BSA Free

Western Blot: RalA/RalB Antibody [NBP1-79633]

Western Blot: RalA/RalB Antibody [NBP1-79633]

Western Blot: RalA/RalB Antibody [NBP1-79633] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
Immunohistochemistry: RalA/RalB Antibody [NBP1-79633]

Immunohistochemistry: RalA/RalB Antibody [NBP1-79633]

Immunohistochemistry: RalA/RalB Antibody [NBP1-79633] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic in endothelial cells in blood vessels, plasma membrane in cardiomyocytes Primary Antibody Concentration: 1:100 Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Applications for RalA/RalB Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RalA/RalB

The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins.

Long Name

Ras-like Protein A/B

Alternate Names

MGC48949, RAL, Ras family small GTP binding protein RALA, RAS-like protein A, ras-related protein Ral-A, v-ral simian leukemia viral oncogene homolog A (ras related)

Gene Symbol

RALA

Additional RalA/RalB Products

Product Documents for RalA/RalB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RalA/RalB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RalA/RalB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RalA/RalB Antibody - BSA Free and earn rewards!

Have you used RalA/RalB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...