![Western Blot: RALY Antibody [NBP2-13201]](https://resources.rndsystems.com/images/products/RALY-Antibody-Western-Blot-NBP2-13201-img0014.jpg "Western Blot: RALY Antibody [NBP2-13201]")
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Orthogonal Validation, Independent Antibodies
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: RLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RALY Antibody - BSA Free
![Immunocytochemistry/ Immunofluorescence: RALY Antibody [NBP2-13201]](https://resources.rndsystems.com/images/products/RALY-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13201-img0007.jpg "Immunocytochemistry/ Immunofluorescence: RALY Antibody [NBP2-13201]")
Immunocytochemistry/ Immunofluorescence: RALY Antibody [NBP2-13201]
Immunocytochemistry/Immunofluorescence: RALY Antibody [NBP2-13201] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.![Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]](https://resources.rndsystems.com/images/products/RALY-Antibody-Immunohistochemistry-Paraffin-NBP2-13201-img0015.jpg "Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]")
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human colon.![Western Blot: RALY Antibody [NBP2-13201]](https://resources.rndsystems.com/images/products/RALY-Antibody-Western-Blot-NBP2-13201-img0008.jpg "Western Blot: RALY Antibody [NBP2-13201]")
Western Blot: RALY Antibody [NBP2-13201]
Western Blot: RALY Antibody [NBP2-13201] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)![Western Blot: RALY Antibody [NBP2-13201]](https://resources.rndsystems.com/images/products/RALY-Antibody-Western-Blot-NBP2-13201-img0012.jpg "Western Blot: RALY Antibody [NBP2-13201]")
![Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]](https://resources.rndsystems.com/images/products/RALY-Antibody-Immunohistochemistry-Paraffin-NBP2-13201-img0006.jpg "Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]")
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human kidney shows strong nuclear positivity in cells in tubules and cells in glomeruli.![Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]](https://resources.rndsystems.com/images/products/RALY-Antibody-Immunohistochemistry-Paraffin-NBP2-13201-img0009.jpg "Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]")
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human liver shows low expression as expected.![Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]](https://resources.rndsystems.com/images/products/RALY-Antibody-Immunohistochemistry-Paraffin-NBP2-13201-img0010.jpg "Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]")
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human testis shows high expression.![Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]](https://resources.rndsystems.com/images/products/RALY-Antibody-Immunohistochemistry-Paraffin-NBP2-13201-img0013.jpg "Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]")
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human colon, liver, lymph node and testis using Anti-RALY antibody NBP2-13201 (A) shows similar protein distribution across tissues to independent antibody NBP2-13200 (B).![Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]](https://resources.rndsystems.com/images/products/RALY-Antibody-Immunohistochemistry-Paraffin-NBP2-13201-img0016.jpg "Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]")
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201]
Immunohistochemistry-Paraffin: RALY Antibody [NBP2-13201] - Staining of human lymph node.![RALY Antibody - BSA Free Western Blot: RALY Antibody - BSA Free [NBP2-13201]](https://resources.rndsystems.com/images/products/nbp2-13201_rabbit-polyclonal-raly-antibody-3052025726380.jpg "Western Blot: RALY Antibody - BSA Free [NBP2-13201]")
Western Blot: RALY Antibody - BSA Free [NBP2-13201]
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
![RALY Antibody - BSA Free Immunohistochemistry: RALY Antibody - BSA Free [NBP2-13201]](https://resources.rndsystems.com/images/products/nbp2-13201_rabbit-polyclonal-raly-antibody-30520257552914.jpg "Immunohistochemistry: RALY Antibody - BSA Free [NBP2-13201]")
Applications for RALY Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RALY
Alternate Names
Autoantigen p542, Heterogeneous nuclear ribonucleoprotein C-like 2, hnRNP associated with lethal yellow protein homolog, hnRNP core protein C-like 2, HNRPCL2MGC117312, P542hnRNP-associated with lethal yellow), RNA binding protein (autoantigenic, hnRNP-associated with lethal yellow), RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog(mouse)), RNA-binding protein (autoantigenic), RNA-binding protein Raly
Gene Symbol
RALY
Additional RALY Products
Product Documents for RALY Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RALY Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for RALY Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RALY Antibody - BSA Free and earn rewards!
Have you used RALY Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...