RAP1A Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35089

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 39-138 of human RAP1A (NP_002875.1).

Sequence:
SYRKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RAP1A Antibody - BSA Free

RAP1A Antibody

Immunohistochemistry: RAP1A Antibody [NBP3-35089] -

Immunohistochemistry: RAP1A Antibody [NBP3-35089] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using [KO Validated] RAP1A Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
RAP1A Antibody

Immunohistochemistry: RAP1A Antibody [NBP3-35089] -

Immunohistochemistry: RAP1A Antibody [NBP3-35089] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using [KO Validated] RAP1A Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
RAP1A Antibody

Western Blot: RAP1A Antibody [NBP3-35089] -

Western Blot: RAP1A Antibody [NBP3-35089] - Western blot analysis of lysates from wild type(WT) and RAP1A knockdown (KD) 293T cells, using [KO Validated] RAP1A Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
RAP1A Antibody

Immunohistochemistry: RAP1A Antibody [NBP3-35089] -

Immunohistochemistry: RAP1A Antibody [NBP3-35089] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using [KO Validated] RAP1A Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
RAP1A Antibody

Western Blot: RAP1A Antibody [NBP3-35089] -

Western Blot: RAP1A Antibody [NBP3-35089] - Western blot analysis of various lysates using [KO Validated] RAP1A Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.

Applications for RAP1A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Rap1A

The product of this gene belongs to the family of RAS-related proteins. These proteins share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. The most striking difference between RAP proteins and RAS proteins resides in their 61st amino acid: glutamine in RAS is replaced by threonine in RAP proteins. The product of this gene counteracts the mitogenic function of RAS because it can interact with RAS GAPs and RAF in a competitive manner. Two transcript variants encoding the same protein have been identified for this gene.

Long Name

Ras-related Protein 1A

Alternate Names

KREV-1, SMGP21

Gene Symbol

RAP1A

Additional Rap1A Products

Product Documents for RAP1A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAP1A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAP1A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAP1A Antibody - BSA Free and earn rewards!

Have you used RAP1A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...