Ras-related Protein 1A (Rap1A) and Ras-related Protein 1B (Rap1B) are membrane-localized members of the Ras small GTPase superfamily of proteins. Rap1A and Rap1B are 184 amino acid (aa) propeptides that are processed into mature 181 aa proteins each with a predicted molecular mass of 21 kDa. Rap1A appears to play a vital role in the cardiovascular system where it regulates cell attachment, migration, and cell-cell junction formation. Rap1A counteracts the mitogenic functions of Ras and several reports suggest that it mediates the progression of multiple cancers where it may regulate metastasis. Rap1B has also been shown to participate in the organization of the vascular lumen by regulating endothelial cell polarity. It also plays a significant role in platelet function, where it mediates adhesion signaling.
Rap1A/B Antibody (6C7G0)
Novus Biologicals | Catalog # NBP3-16868
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 6C7G0 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 70-150 of human Rap1A/B (P61224). LYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKS
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Rap1A/B Antibody (6C7G0)
Western Blot: Rap1A/B Antibody (6C7G0) [NBP3-16868]
Western Blot: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Western blot analysis of extracts of various cell lines, using Rap1A/B Rabbit mAb (NBP3-16868) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868]
Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of U-2 OS cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868]
Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of C6 cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868]
Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of NIH-3T3 cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Applications for Rap1A/B Antibody (6C7G0)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Rap1A/B
Long Name
Ras-related Protein 1A/B
Alternate Names
RAP1A, RAP1B
Gene Symbol
RAP1A
Additional Rap1A/B Products
Product Documents for Rap1A/B Antibody (6C7G0)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Rap1A/B Antibody (6C7G0)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Rap1A/B Antibody (6C7G0)
There are currently no reviews for this product. Be the first to review Rap1A/B Antibody (6C7G0) and earn rewards!
Have you used Rap1A/B Antibody (6C7G0)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...