Rap1A/B Antibody (6C7G0)

Novus Biologicals | Catalog # NBP3-16868

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6C7G0 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-150 of human Rap1A/B (P61224). LYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Rap1A/B Antibody (6C7G0)

Western Blot: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Western Blot: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Western Blot: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Western blot analysis of extracts of various cell lines, using Rap1A/B Rabbit mAb (NBP3-16868) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of U-2 OS cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of C6 cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Immunocytochemistry/ Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868]

Immunocytochemistry/Immunofluorescence: Rap1A/B Antibody (6C7G0) [NBP3-16868] - Immunofluorescence analysis of NIH-3T3 cells using Rap1A/B Rabbit mAb (NBP3-16868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for Rap1A/B Antibody (6C7G0)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Rap1A/B

Ras-related Protein 1A (Rap1A) and Ras-related Protein 1B (Rap1B) are membrane-localized members of the Ras small GTPase superfamily of proteins. Rap1A and Rap1B are 184 amino acid (aa) propeptides that are processed into mature 181 aa proteins each with a predicted molecular mass of 21 kDa. Rap1A appears to play a vital role in the cardiovascular system where it regulates cell attachment, migration, and cell-cell junction formation. Rap1A counteracts the mitogenic functions of Ras and several reports suggest that it mediates the progression of multiple cancers where it may regulate metastasis. Rap1B has also been shown to participate in the organization of the vascular lumen by regulating endothelial cell polarity. It also plays a significant role in platelet function, where it mediates adhesion signaling.

Long Name

Ras-related Protein 1A/B

Alternate Names

RAP1A, RAP1B

Gene Symbol

RAP1A

Additional Rap1A/B Products

Product Documents for Rap1A/B Antibody (6C7G0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Rap1A/B Antibody (6C7G0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rap1A/B Antibody (6C7G0)

There are currently no reviews for this product. Be the first to review Rap1A/B Antibody (6C7G0) and earn rewards!

Have you used Rap1A/B Antibody (6C7G0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...