RAP30 Antibody (3T7Q9)

Novus Biologicals | Catalog # NBP3-15275

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3T7Q9 expressed in HEK293
View all RAP30 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RAP30 (P13984). MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RAP30 Antibody (3T7Q9)

Western Blot: RAP30 Antibody (3T7Q9) [NBP3-15275]

Western Blot: RAP30 Antibody (3T7Q9) [NBP3-15275]

Western Blot: RAP30 Antibody (3T7Q9) [NBP3-15275] - Western blot analysis of extracts of various cell lines, using RAP30 antibody (NBP3-15275) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: RAP30 Antibody (3T7Q9) [NBP3-15275]

Immunohistochemistry-Paraffin: RAP30 Antibody (3T7Q9) [NBP3-15275]

Immunohistochemistry-Paraffin: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry of paraffin-embedded rat testis using RAP30 Rabbit mAb (NBP3-15275) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: RAP30 Antibody (3T7Q9) [NBP3-15275]

Immunohistochemistry-Paraffin: RAP30 Antibody (3T7Q9) [NBP3-15275]

Immunohistochemistry-Paraffin: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry of paraffin-embedded human esophageal using RAP30 Rabbit mAb (NBP3-15275) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: RAP30 Antibody (3T7Q9) [NBP3-15275]

Immunohistochemistry-Paraffin: RAP30 Antibody (3T7Q9) [NBP3-15275]

Immunohistochemistry-Paraffin: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry of paraffin-embedded mouse kidney using RAP30 Rabbit mAb (NBP3-15275) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
RAP30 Antibody (3T7Q9)

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] -

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry analysis of RAP30 in paraffin-embedded human colon tissue using RAP30 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
RAP30 Antibody (3T7Q9)

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] -

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry analysis of RAP30 in paraffin-embedded human lung tissue using RAP30 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
RAP30 Antibody (3T7Q9)

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] -

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry analysis of RAP30 in paraffin-embedded human esophagus tissue using RAP30 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
RAP30 Antibody (3T7Q9)

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] -

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry analysis of RAP30 in paraffin-embedded mouse testis tissue using RAP30 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
RAP30 Antibody (3T7Q9)

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] -

Immunohistochemistry: RAP30 Antibody (3T7Q9) [NBP3-15275] - Immunohistochemistry analysis of RAP30 in paraffin-embedded rat colon tissue using RAP30 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for RAP30 Antibody (3T7Q9)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RAP30

Predicted to enable RNA polymerase II general transcription initiation factor activity. Involved in transcription by RNA polymerase II. Located in microtubule cytoskeleton and nucleoplasm. Part of transcription preinitiation complex.

Alternate Names

ATP-dependent helicase GTF2F2, BTF4, General transcription factor IIF 30 kDa subunit, general transcription factor IIF subunit 2, general transcription factor IIF, polypeptide 2, 30kDa, TF2F2, TFIIF, TFIIF-beta, Transcription initiation factor IIF subunit beta, Transcription initiation factor RAP30

Gene Symbol

GTF2F2

Additional RAP30 Products

Product Documents for RAP30 Antibody (3T7Q9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RAP30 Antibody (3T7Q9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RAP30 Antibody (3T7Q9)

There are currently no reviews for this product. Be the first to review RAP30 Antibody (3T7Q9) and earn rewards!

Have you used RAP30 Antibody (3T7Q9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies