RAP80 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87156

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies, Biological Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunomicroscopy, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, Immunomicroscopy, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RAP80 Antibody - BSA Free

Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]

Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]

Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-UIMC1 antibody NBP1-87156 (A) shows similar protein distribution across tissues to independent antibody NBP1-87157 (B).
Western Blot: RAP80 Antibody [NBP1-87156]

Western Blot: RAP80 Antibody [NBP1-87156]

Western Blot: RAP80 Antibody [NBP1-87156] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156]

Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156]

RAP80-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87156-img0018.jpg
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]

Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]

Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human testis.
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156]

Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156]

Immunocytochemistry/Immunofluorescence: RAP80 Antibody [NBP1-87156] - Staining of human cell line U-2 OS shows localization to nucleus & nuclear bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]

Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]

Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human cerebral cortex using Anti-UIMC1 antibody.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]

Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]

Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human colon using Anti-UIMC1 antibody.
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]

Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]

Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human lymph node using Anti-UIMC1 antibody.
RAP80 Antibody

Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] -

Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] - EHMT1 & EHMT2 are required for accumulation of ubiquitin conjugates & repair factors at DNA damage sites. (a,b) Immunofluorescence analysis of U2OS cells (a) & MCF7 (b) cells transfected with indicated siRNA, & co-immunostained with indicated antibodies at 2 h after exposure to neocarzinostatin (NCS, 50 ng/ml for 15 min). A representative image of each treated or control cells is shown, as indicated. DNA damage induced foci are quantified as the percentage of cells with more than 5 large foci in nuclei after background subtraction, each based on at least 150 cells from three independent experiments (right). Error bars represent standard deviation (SD). Statistical significance was calculated using two-tailed, unpaired t-test compared with control cells; *P < 0.0001. The knockdown efficiencies with individual siRNAs against EHMT1 & EHMT2 are shown in Fig. S3a,b. Scale bar, 10 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30022091), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
RAP80 Antibody

Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] -

Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] - NHEJ pathway inhibition rescue HR & cell survival in FA cells. (A) Representative images of pDNA-PKcs (red) & MRE11 (green) foci in nuclei (DAPI stained, blue) of FANCC-corrected (PD331 corr) or FANCC-mutated (PD331 FANCC−/−) cells in which 53BP1 was depleted by siRNA White line: 2 μm. (B) Histogram presents the frequency of MRE11-positive FANCC−/− cells 48 h after 53BP1 downregulation by siRNA transfection. The presented data are the mean of three independent experiments; error bars indicate S.D. *** indicates P < 0.001 using a Student's t-test. (C) Representative images of pDNA-PKcs (red), 53BP1 (green), RAP80 (red) or MRE11 (green) foci in nuclei (DAPI stained, blue) of FANCC-deficient cells (PD331 FANC−/−) treated with DMSO or with a DNA-PK specific inhibitor. The cells were treated with DNA-PK inhibitor (DNA-PKi 10 μm) for 2 h before MMC exposure (200 ng/ml). White line: 2 μm. (D & E) Clonogenic survival of FANCC-proficient (D, PD331 corr) or -mutated (E, PD331 FANCC−/−) cells after 53BP1 depletion by siRNA and/or DNA-PK inhibition. The cells were treated with MMC at the indicated doses. The presented data are the mean of three independent experiments; error bars indicate S.D. * indicates P < 0.05 using a Student's t-test. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/26446986), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for RAP80 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Immunomicroscopy

Reported in scientific literature (PMID:33450211)

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAP80

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. TRAP80 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. TRAP80 is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed 12910245; Barry and Johnston PubMed: 9234514). The animals cells produce the protein, which stimulates the animals immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Long Name

Receptor Associated Protein 80

Alternate Names

RXRIP110, UIMC1, X2HRIP110

Entrez Gene IDs

51720 (Human)

Gene Symbol

UIMC1

UniProt

Additional RAP80 Products

Product Documents for RAP80 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAP80 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RAP80 Antibody - BSA Free

Customer Reviews for RAP80 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAP80 Antibody - BSA Free and earn rewards!

Have you used RAP80 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...