RAP80 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-87156
Loading...
Key Product Details
Validated by
Independent Antibodies, Biological Validation
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunomicroscopy, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry-Paraffin, Immunomicroscopy, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSG
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RAP80 Antibody - BSA Free
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-UIMC1 antibody NBP1-87156 (A) shows similar protein distribution across tissues to independent antibody NBP1-87157 (B).Western Blot: RAP80 Antibody [NBP1-87156]
Western Blot: RAP80 Antibody [NBP1-87156] - Analysis in human cell line HDLM-2.Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human testis.Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156]
Immunocytochemistry/Immunofluorescence: RAP80 Antibody [NBP1-87156] - Staining of human cell line U-2 OS shows localization to nucleus & nuclear bodies. Antibody staining is shown in green.Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human cerebral cortex using Anti-UIMC1 antibody.Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human colon using Anti-UIMC1 antibody.Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156]
Immunohistochemistry-Paraffin: RAP80 Antibody [NBP1-87156] - Staining of human lymph node using Anti-UIMC1 antibody.Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] -
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] - EHMT1 & EHMT2 are required for accumulation of ubiquitin conjugates & repair factors at DNA damage sites. (a,b) Immunofluorescence analysis of U2OS cells (a) & MCF7 (b) cells transfected with indicated siRNA, & co-immunostained with indicated antibodies at 2 h after exposure to neocarzinostatin (NCS, 50 ng/ml for 15 min). A representative image of each treated or control cells is shown, as indicated. DNA damage induced foci are quantified as the percentage of cells with more than 5 large foci in nuclei after background subtraction, each based on at least 150 cells from three independent experiments (right). Error bars represent standard deviation (SD). Statistical significance was calculated using two-tailed, unpaired t-test compared with control cells; *P < 0.0001. The knockdown efficiencies with individual siRNAs against EHMT1 & EHMT2 are shown in Fig. S3a,b. Scale bar, 10 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30022091), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] -
Immunocytochemistry/ Immunofluorescence: RAP80 Antibody [NBP1-87156] - NHEJ pathway inhibition rescue HR & cell survival in FA cells. (A) Representative images of pDNA-PKcs (red) & MRE11 (green) foci in nuclei (DAPI stained, blue) of FANCC-corrected (PD331 corr) or FANCC-mutated (PD331 FANCC−/−) cells in which 53BP1 was depleted by siRNA White line: 2 μm. (B) Histogram presents the frequency of MRE11-positive FANCC−/− cells 48 h after 53BP1 downregulation by siRNA transfection. The presented data are the mean of three independent experiments; error bars indicate S.D. *** indicates P < 0.001 using a Student's t-test. (C) Representative images of pDNA-PKcs (red), 53BP1 (green), RAP80 (red) or MRE11 (green) foci in nuclei (DAPI stained, blue) of FANCC-deficient cells (PD331 FANC−/−) treated with DMSO or with a DNA-PK specific inhibitor. The cells were treated with DNA-PK inhibitor (DNA-PKi 10 μm) for 2 h before MMC exposure (200 ng/ml). White line: 2 μm. (D & E) Clonogenic survival of FANCC-proficient (D, PD331 corr) or -mutated (E, PD331 FANCC−/−) cells after 53BP1 depletion by siRNA and/or DNA-PK inhibition. The cells were treated with MMC at the indicated doses. The presented data are the mean of three independent experiments; error bars indicate S.D. * indicates P < 0.05 using a Student's t-test. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/26446986), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for RAP80 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Immunomicroscopy
Reported in scientific literature (PMID:33450211)
Western Blot
0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RAP80
Long Name
Receptor Associated Protein 80
Alternate Names
RXRIP110, UIMC1, X2HRIP110
Entrez Gene IDs
51720 (Human)
Gene Symbol
UIMC1
UniProt
Additional RAP80 Products
Product Documents for RAP80 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RAP80 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for RAP80 Antibody - BSA Free
Customer Reviews for RAP80 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RAP80 Antibody - BSA Free and earn rewards!
Have you used RAP80 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...