RAPGEF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88124

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of mouse RAPGEF2. Peptide sequence: GHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQSRA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for RAPGEF2 Antibody - BSA Free

Western Blot: RAPGEF2 Antibody [NBP2-88124]

Western Blot: RAPGEF2 Antibody [NBP2-88124]

Western Blot: RAPGEF2 Antibody [NBP2-88124] - Host: Rabbit. Target Name: Rapgef2. Sample Type: Mouse Brain lysates. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124]

Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124]

Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124] - Rabbit Anti-RAPGEF2 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Small Intestine. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200.
Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124]

Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124]

Immunohistochemistry-Paraffin: RAPGEF2 Antibody [NBP2-88124] - Rabbit Anti-RAPGEF2 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adrenal. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x.

Applications for RAPGEF2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RAPGEF2

Members of the RAS (see HRAS; MIM 190020) subfamily of GTPases function in signal transduction as GTP/GDP-regulated switches that cycle between inactive GDP- and active GTP-bound states. Guanine nucleotide exchange factors (GEFs), such as RAPGEF2, serve as RAS activators by promoting acquisition of GTP to maintain the active GTP-bound state and are the key link between cell surface receptors and RAS activation (Rebhun et al., 2000 [PubMed 10934204]).[supplied by OMIM]

Alternate Names

CNrasGEF, KIAA0313, Neural RAP guanine nucleotide exchange protein, nRap GEP, NRAPGEP, PDZ domain containing guanine nucleotide exchange factor (GEF) 1, PDZGEF1, PDZ-GEF1PDZ domain-containing guanine nucleotide exchange factor 1, RA(Ras/Rap1A-associating)-GEF, RA-GEFDKFZP586O1422, Rap guanine nucleotide exchange factor (GEF) 2, rap guanine nucleotide exchange factor 2, Rap-GEP

Gene Symbol

RAPGEF2

Additional RAPGEF2 Products

Product Documents for RAPGEF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RAPGEF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RAPGEF2 Antibody - BSA Free

Customer Reviews for RAPGEF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RAPGEF2 Antibody - BSA Free and earn rewards!

Have you used RAPGEF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...