RBM8A Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88376

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Predicted:

Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RBM8A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31672445).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RBM8A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: RBM8A Antibody [NBP1-88376]

Immunocytochemistry/ Immunofluorescence: RBM8A Antibody [NBP1-88376]

Immunocytochemistry/Immunofluorescence: RBM8A Antibody [NBP1-88376] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.
RBM8A Antibody

Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] -

Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.
RBM8A Antibody

Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] -

Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.
RBM8A Antibody

Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] -

Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
RBM8A Antibody

Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] -

Immunohistochemistry-Paraffin: RBM8A Antibody [NBP1-88376] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
RBM8A Antibody - BSA Free Western Blot: RBM8A Antibody - BSA Free [NBP1-88376]

Western Blot: RBM8A Antibody - BSA Free [NBP1-88376]

Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RBM8A antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Applications for RBM8A Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RBM8A

Pre-mRNA splicing appears to play an important role in regulation of gene expression. It has been shown in a number of studies that during the splicing process, specific proteins are recruited to the mRNA and assemble into a complex of mRNA-protein near the exon-exon junction. This complex is termed mRNA-protein complex (mRNP), or the exon-exon junction complex. Several proteins were found to be present in this complex including Y14, magoh, Aly/REF, RNPS1, Upf3, and DEK. Y14 is a 174 amino acid RNA-binding protein that contains one RNA-binding domain in the middle of the protein. Y14 binds to the spliced mRNAs in the nucleus and is exported with the mRNA to the cytoplasm. Similar to other proteins in the mRNA-protein complex, Y14 can interact with the mRNA export factor TAP and enhance the export of the mRNAs. Y14 binds to different mRNAs approx.

Alternate Names

Binder of OVCA1-1, BOV-1, BOV-1A, BOV-1B, BOV-1C, MDS014, RBM8BRBM8, ribonucleoprotein RBM8, Ribonucleoprotein RBM8A, RNA binding motif protein 8A, RNA binding motif protein 8B, RNA-binding motif protein 8A, RNA-binding protein 8A, RNA-binding protein Y14, Y14, ZNRP, ZRNP1

Gene Symbol

RBM8A

Additional RBM8A Products

Product Documents for RBM8A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RBM8A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RBM8A Antibody - BSA Free

Customer Reviews for RBM8A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RBM8A Antibody - BSA Free and earn rewards!

Have you used RBM8A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies