RBMS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57279

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RBMS1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QSPSWMQPQPYILQHPGAVLTPSMEHTMSLQP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RBMS1 Antibody - BSA Free

Western Blot: RBMS1 Antibody [NBP2-57279]

Western Blot: RBMS1 Antibody [NBP2-57279]

Western Blot: RBMS1 Antibody [NBP2-57279] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: RBMS1 Antibody [NBP2-57279]

Immunocytochemistry/ Immunofluorescence: RBMS1 Antibody [NBP2-57279]

Immunocytochemistry/Immunofluorescence: RBMS1 Antibody [NBP2-57279] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Applications for RBMS1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RBMS1

RBMS1 encodes a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. Multiple transcript variants, resulting from alternative splicing and encoding different isoforms, have been described. Several of these were isolated by virtue of their binding to either strand of an upstream element of c-myc (MSSPs), or by phenotypic complementation of cdc2 and cdc13 mutants of yeast (scr2), or as a potential human repressor of HIV-1 and ILR-2 alpha promoter transcription (YC1). A pseudogene for this locus is found on chromosome 12.

Alternate Names

chromosome 2 open reading frame 12, DKFZp564H0764, HCC-4, MGC15146, MGC3331, MGC97258, MGC97270, MGC97282, MGC99543, MSSP1, MSSP-1, MSSP-2, MSSP-3, RNA binding motif, single stranded interacting protein 1, SCR2MGC70597, single-stranded-interacting protein 1, suppressor of cdc 2 (cdc13) with RNA binding motif 2

Gene Symbol

RBMS1

Additional RBMS1 Products

Product Documents for RBMS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RBMS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RBMS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RBMS1 Antibody - BSA Free and earn rewards!

Have you used RBMS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies