RBP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85464

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RBP2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVC

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RBP2 Antibody - BSA Free

Western Blot: RBP2 Antibody [NBP1-85464]

Western Blot: RBP2 Antibody [NBP1-85464]

Western Blot: RBP2 Antibody [NBP1-85464] - Analysis in control (vector only transfected HEK293T lysate) and RBP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: RBP2 Antibody [NBP1-85464]

Immunocytochemistry/ Immunofluorescence: RBP2 Antibody [NBP1-85464]

Immunocytochemistry/Immunofluorescence: RBP2 Antibody [NBP1-85464] - Immunofluorescent staining of human cell line CACO-2 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464]

Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464]

Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464] - Staining in human duodenum and liver tissues using anti-RBP2 antibody. Corresponding RBP2 RNA-seq data are presented for the same tissues.
Western Blot: RBP2 Antibody [NBP1-85464]

Western Blot: RBP2 Antibody [NBP1-85464]

Western Blot: RBP2 Antibody [NBP1-85464] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464]

Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464]

Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464]

Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464]

Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464] - Staining of human liver shows low expression as expected.

Applications for RBP2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RBP2

RBP2 is an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. RBP2 may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle. [provided by RefSeq]

Alternate Names

cellular, Cellular retinol-binding protein II, CRABP-II, CRBP2CRBP-II, retinol binding protein 2, cellular

Gene Symbol

RBP2

Additional RBP2 Products

Product Documents for RBP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RBP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RBP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RBP2 Antibody - BSA Free and earn rewards!

Have you used RBP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies