RCN2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32011

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RCN2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VTWDEYNIQMYDRVIDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RCN2 Antibody - BSA Free

Western Blot: RCN2 Antibody [NBP2-32011]

Western Blot: RCN2 Antibody [NBP2-32011]

Western Blot: RCN2 Antibody [NBP2-32011] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: RCN2 Antibody [NBP2-32011]

Immunocytochemistry/ Immunofluorescence: RCN2 Antibody [NBP2-32011]

Immunocytochemistry/Immunofluorescence: RCN2 Antibody [NBP2-32011] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining in human epididymis and pancreas tissues using anti-RCN2 antibody. Corresponding RCN2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining of human cerebral cortex, epididymis, pancreas and testis using Anti-RCN2 antibody NBP2-32011 (A) shows similar protein distribution across tissues to independent antibody NBP2-32010 (B).
Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011]

Immunohistochemistry-Paraffin: RCN2 Antibody [NBP2-32011] - Staining of human testis.

Applications for RCN2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RCN2

Reticulocalbin 2 is a calcium-binding protein located in the lumen of the ER. The protein contains six conserved regions with similarity to a high affinity Ca(+2)-binding motif, the EF-hand. The RCN2 gene maps to the same region as type 4 Bardet-Biedl syndrome (MIM:600374), suggesting a possible causative role for reticulocalbin 2 in the disorder. [provided by RefSeq]

Alternate Names

Calcium-binding protein ERC-55, E6BPreticulocalbin 2, EF-hand calcium binding domain (endoplasmic reticulumcalcium-binding protein, 55kD), ERC-55, ERC55E6-binding protein, reticulocalbin 2, EF-hand calcium binding domain, reticulocalbin-2, TCBP49

Gene Symbol

RCN2

UniProt

Q14257 (Human)

Additional RCN2 Products

Product Documents for RCN2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RCN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RCN2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RCN2 Antibody - BSA Free and earn rewards!

Have you used RCN2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies