RECQ1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57572

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RECQ1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCCKDSAFERKNITEYCRDLIKILKQ

Reactivity Notes

Mouse 87%, Rat 87%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RECQ1 Antibody - BSA Free

Western Blot: RECQ1 Antibody [NBP2-57572]

Western Blot: RECQ1 Antibody [NBP2-57572]

Western Blot: RECQ1 Antibody [NBP2-57572] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: RECQ1 Antibody [NBP2-57572]

Immunocytochemistry/ Immunofluorescence: RECQ1 Antibody [NBP2-57572]

Immunocytochemistry/Immunofluorescence: RECQ1 Antibody [NBP2-57572] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Applications for RECQ1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RECQ1

RECQ1 is encoded by this gene is a member of the RecQ DNA helicase family. DNA helicases are enzymes involved in various types of DNA repair, including mismatch repair, nucleotide excision repair and direct repair. Some members of this family are associated with genetic disorders with predisposition to malignancy and chromosomal instability. The biological function of this helicase has not yet been determined. Two alternatively spliced transcripts, which encode the same isoform but differ in their 5' and 3' UTRs, have been described.

Alternate Names

DNA helicase, RecQ-like type 1, DNA-dependent ATPase Q1, EC 3.6.1, EC 3.6.4.12, RecQ protein-like (DNA helicase Q1-like), RecQ protein-like 1, RECQ1, RecQ1ATP-dependent DNA helicase Q1, RecQL1

Gene Symbol

RECQL

Additional RECQ1 Products

Product Documents for RECQ1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RECQ1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RECQ1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RECQ1 Antibody - BSA Free and earn rewards!

Have you used RECQ1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies