![Reg1A Antibody - BSA Free Immunohistochemistry: Reg1A Antibody - BSA Free [NBP2-13215]](https://resources.rndsystems.com/images/products/nbp2-13215_rabbit-polyclonal-reg1a-antibody-29520251615341.jpg "Immunohistochemistry: Reg1A Antibody - BSA Free [NBP2-13215]")
Reg1A, also known as PTP, PSP, and lithostathine, is a member of the Reg family of secreted proteins with a C-type lectin domain. Due to variable glycosylation, pancreatic Reg1A exists as multiple species of 16 - 18 kDa. Reg1A promotes the maintenance and growth of pancreatic islet β-cells and intestinal villi. It is upregulated in pancreatitis and some carcinomas. Reg1A is an antigenic target in autoimmune diabetes. Human Reg1A shares 65% - 68% aa sequence identity with mouse and rat Reg1A.
Reg1A Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-13215
![Western Blot: Reg1A Antibody [NBP2-13215]](https://resources.rndsystems.com/images/products/Reg1A-Antibody-Western-Blot-NBP2-13215-img0003.jpg "Western Blot: Reg1A Antibody [NBP2-13215]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSV
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Reg1A Antibody - BSA Free
Western Blot: Reg1A Antibody [NBP2-13215]
Western Blot: Reg1A Antibody [NBP2-13215] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue![Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215]](https://resources.rndsystems.com/images/products/Reg1A-Antibody-Immunohistochemistry-Paraffin-NBP2-13215-img0007.jpg "Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215]")
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215]
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Staining of human liver shows no positivity in hepatocytes as expected.![Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215]](https://resources.rndsystems.com/images/products/Reg1A-Antibody-Immunohistochemistry-Paraffin-NBP2-13215-img0005.jpg "Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215]")
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215]
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.![Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215]](https://resources.rndsystems.com/images/products/Reg1A-Antibody-Immunohistochemistry-Paraffin-NBP2-13215-img0006.jpg "Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215]")
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215]
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.![Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215]](https://resources.rndsystems.com/images/products/Reg1A-Antibody-Immunohistochemistry-Paraffin-NBP2-13215-img0008.jpg "Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215]")
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215]
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Staining of human kidney shows no positivity in cells in tubules as expected.![Reg1A Antibody - BSA Free Western Blot: Reg1A Antibody - BSA Free [NBP2-13215]](https://resources.rndsystems.com/images/products/nbp2-13215_rabbit-polyclonal-reg1a-antibody-30520259554522.jpg "Western Blot: Reg1A Antibody - BSA Free [NBP2-13215]")
Western Blot: Reg1A Antibody - BSA Free [NBP2-13215]
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Applications for Reg1A Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Reg1A
Long Name
Regenerating Islet-derived 1A
Alternate Names
ICRF, PSP, PTP
Gene Symbol
REG1A
Additional Reg1A Products
Product Documents for Reg1A Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Reg1A Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Reg1A Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Reg1A Antibody - BSA Free and earn rewards!
Have you used Reg1A Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Reg1A Antibody - BSA Free
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: Please send me the detail of positive control which I can use in the IHC for the Reg1 alpha antibody with catalog number NBP2-13215.
A: Pancreas and Small intestine/Duodenum would be the best option as positive controls when performing IHC-P with Reg1 antibody with the catalog number NBP2-13215. Stomach can be another option if Pancreas or Small intestine/Duodenum is not available.
Loading...