Rffl Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83427

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Rffl Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MKVKDLRDYLSLHDISTEMCREKEELVLLVLGQQPVISQEDRTRASTLSPDFPEQQAFLTQPHSSMVPPTSPNLPSSS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Rffl Antibody - BSA Free

Rffl Antibody - BSA Free Immunohistochemistry-Paraffin: Rffl Antibody - BSA Free [NBP1-83427]

Immunohistochemistry-Paraffin: Rffl Antibody - BSA Free [NBP1-83427]

Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.
Rffl Antibody - BSA Free Immunohistochemistry-Paraffin: Rffl Antibody - BSA Free [NBP1-83427]

Immunohistochemistry-Paraffin: Rffl Antibody - BSA Free [NBP1-83427]

Staining of human lymphoid tissues shows strong membranous and cytoplasmic positivity in non-germinal center cells.
Rffl Antibody - BSA Free Western Blot: Rffl Antibody - BSA Free [NBP1-83427]

Western Blot: Rffl Antibody - BSA Free [NBP1-83427]

Analysis in human cell line CAPAN-2.
Rffl Antibody - BSA Free Immunohistochemistry-Paraffin: Rffl Antibody - BSA Free [NBP1-83427]

Immunohistochemistry-Paraffin: Rffl Antibody - BSA Free [NBP1-83427]

Staining of human liver shows moderate membranous and cytoplasmic positivity in hepatocytes.
Rffl Antibody - BSA Free Immunohistochemistry-Paraffin: Rffl Antibody - BSA Free [NBP1-83427]

Immunohistochemistry-Paraffin: Rffl Antibody - BSA Free [NBP1-83427]

Staining of human small intestine shows strong membranous and cytoplasmic positivity in glandular cells).

Applications for Rffl Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Rffl

RFFL, also known as Rififylin, RING finger and FYVE-like domain-containing protein 1, FYVE-RING finger protein, Sakura, Fring, Caspases-8 and -10-associated RING finger protein 2, CARP-2, Caspase regulator CARP2, RING finger protein 189 and RING finger protein 34-like, is a novel modulator of NF-kB activation. RFFL possesses E3 ubiquitin protein ligase activity and has been shown to regulate the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. RFFL also possesses anti-apoptotic activity and may bind phosphatidylinositol phosphates. RFFL is a membrane bound cytoplasmic protein that is expressed ubiquitously. RFFL can be detected in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes and is rapidly degraded after stimulation with TNFSF10, and probably by caspases. Multiple transcript variants have been detected for this protein.

Alternate Names

CARP-2, Caspase regulator CARP2, Caspases-8 and -10-associated RING finger protein 2, E3 ubiquitin-protein ligase rififylin, EC 6.3.2, EC 6.3.2.-, Fring, FYVE-RING finger protein Sakura, rififylin, ring finger and FYVE-like domain containing 1, RING finger and FYVE-like domain-containing protein 1, RING finger protein 189, RING finger protein 34-like, RNF189CARP2, RNF34LFRING

Gene Symbol

RFFL

Additional Rffl Products

Product Documents for Rffl Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Rffl Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Rffl Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Rffl Antibody - BSA Free and earn rewards!

Have you used Rffl Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies