RFX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13224

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RFX2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: VMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQGI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RFX2 Antibody - BSA Free

Western Blot: RFX2 Antibody [NBP2-13224]

Western Blot: RFX2 Antibody [NBP2-13224]

Western Blot: RFX2 Antibody [NBP2-13224] - Analysis in human cell line SCLC-21H.
Immunocytochemistry/ Immunofluorescence: RFX2 Antibody [NBP2-13224]

Immunocytochemistry/ Immunofluorescence: RFX2 Antibody [NBP2-13224]

Immunocytochemistry/Immunofluorescence: RFX2 Antibody [NBP2-13224] - Staining of human cell line MCF7 shows localization to nucleoplasm, cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224]

Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224]

Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224]

Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224]

Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224] - Staining of human fallopian tube shows weak nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224]

Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224]

Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224]

Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224]

Immunohistochemistry-Paraffin: RFX2 Antibody [NBP2-13224] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
RFX2 Antibody - BSA Free Immunohistochemistry: RFX2 Antibody - BSA Free [NBP2-13224]

Immunohistochemistry: RFX2 Antibody - BSA Free [NBP2-13224]

Analysis in human testis and liver tissues using NBP2-13224 antibody. Corresponding RFX2 RNA-seq data are presented for the same tissues.
RFX2 Antibody - BSA Free Western Blot: RFX2 Antibody - BSA Free [NBP2-13224]

Western Blot: RFX2 Antibody - BSA Free [NBP2-13224]

Analysis in human cell line SCLC-21H.
RFX2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: RFX2 Antibody - BSA Free [NBP2-13224]

Chromatin Immunoprecipitation-exo-Seq: RFX2 Antibody - BSA Free [NBP2-13224]

ChIP-Exo-Seq composite graph for Anti-RFX2 (NBP2-13224) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for RFX2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RFX2

RFX2 is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. This protein can bind to cis elements in the promoter of the IL-5 receptor alpha gene. Two transcript variants encoding different isoforms have been described for this gene, and both variants utilize alternative polyadenylation sites. [provided by RefSeq]

Alternate Names

DNA binding protein RFX2, DNA-binding protein RFX2, FLJ14226, HLA class II regulatory factor RFX2, Regulatory factor X 2, regulatory factor X, 2 (influences HLA class II expression), trans-acting regulatory factor 2

Gene Symbol

RFX2

Additional RFX2 Products

Product Documents for RFX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RFX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for RFX2 Antibody - BSA Free

Customer Reviews for RFX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RFX2 Antibody - BSA Free and earn rewards!

Have you used RFX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies