RGS17 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-80839
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTKMESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEY
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for RGS17 Antibody - BSA Free
Western Blot: RGS17 Antibody [NBP1-80839]
Western Blot: RGS17 Antibody [NBP1-80839] - Analysis in control (vector only transfected HEK293T lysate) and RGS17 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).Immunohistochemistry-Paraffin: RGS17 Antibody [NBP1-80839]
Immunohistochemistry-Paraffin: RGS17 Antibody [NBP1-80839] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferus ducts of testis.Immunocytochemistry/ Immunofluorescence: RGS17 Antibody - BSA Free [NBP1-80839] -
RGS17 tissue-specific knockout scheme and effect of cisplatin in RGS17 expression in whole-mount dissection. (A) Genomic organization of RGS17loxp and RGS17−/− alleles. Exon 2 was flanked with the loxP sequence, which was cleaved using Atoh-1CreEr to generate mice with specific RGS17−/− knockout in the hair cells. (B) The cochleae were harvested from wild-type RGS17+/+ and RGS17−/− mice. Whole-mount dissection for basal turn was immunolabeled with RGS17 antibody to validate RGS17 expression. The expression of RGS17 (green) was located in the outer and inner hair cells of wild-type mice. However, RGS17 was not detected in the outer and inner hair cells of knockout mice. (C) Schematic illustration of the experimental design that describes the dosage and route of administration of control or cisplatin (3.5 mg/kg) for two cycles; each cycle consists of a 4-day cisplatin administration followed by a 10-day recovery period. Mice were sacrificed at the end of the second cycle (D), and cochleae were collected and processed for whole-mount dissection. The basal turns of each cochlea were immunolabeled with RGS17 (green) and DAPI (blue). High levels of RGS17 immunolabeling were detected in the outer and inner hair cells of wild-type RGS17+/+ mice treated with cisplatin. Inducible hair cell-specific RGS17 knockdown (RGS17+/−) mice showed a slight increase of RGS17 immunolabeling in the outer and inner hair cells following cisplatin administration. However, a hair cell-specific knockout of RGS17 abolished the immunolabeling of RGS17 in both the outer and inner hair cells. Figures shown are representative of six independent animals per treatment group. Scale bar = 40 um. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40061942), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: RGS17 Antibody - BSA Free [NBP1-80839] -
RGS17 tissue-specific knockout scheme and effect of cisplatin in RGS17 expression in whole-mount dissection. (A) Genomic organization of RGS17loxp and RGS17−/− alleles. Exon 2 was flanked with the loxP sequence, which was cleaved using Atoh-1CreEr to generate mice with specific RGS17−/− knockout in the hair cells. (B) The cochleae were harvested from wild-type RGS17+/+ and RGS17−/− mice. Whole-mount dissection for basal turn was immunolabeled with RGS17 antibody to validate RGS17 expression. The expression of RGS17 (green) was located in the outer and inner hair cells of wild-type mice. However, RGS17 was not detected in the outer and inner hair cells of knockout mice. (C) Schematic illustration of the experimental design that describes the dosage and route of administration of control or cisplatin (3.5 mg/kg) for two cycles; each cycle consists of a 4-day cisplatin administration followed by a 10-day recovery period. Mice were sacrificed at the end of the second cycle (D), and cochleae were collected and processed for whole-mount dissection. The basal turns of each cochlea were immunolabeled with RGS17 (green) and DAPI (blue). High levels of RGS17 immunolabeling were detected in the outer and inner hair cells of wild-type RGS17+/+ mice treated with cisplatin. Inducible hair cell-specific RGS17 knockdown (RGS17+/−) mice showed a slight increase of RGS17 immunolabeling in the outer and inner hair cells following cisplatin administration. However, a hair cell-specific knockout of RGS17 abolished the immunolabeling of RGS17 in both the outer and inner hair cells. Figures shown are representative of six independent animals per treatment group. Scale bar = 40 um. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40061942), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for RGS17 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RGS17
Alternate Names
hRGS17, regulator of G-protein signaling 17, regulator of G-protein signalling 17, RGS-17, RGSZ2
Entrez Gene IDs
26575 (Human)
Gene Symbol
RGS17
UniProt
Additional RGS17 Products
Product Documents for RGS17 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RGS17 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for RGS17 Antibody - BSA Free
Customer Reviews for RGS17 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review RGS17 Antibody - BSA Free and earn rewards!
Have you used RGS17 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...