RHBDD2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92330

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RHBDD2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HMPTLPPYQPASGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSRVP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RHBDD2 Antibody - BSA Free

Western Blot: RHBDD2 Antibody [NBP1-92330]

Western Blot: RHBDD2 Antibody [NBP1-92330]

Western Blot: RHBDD2 Antibody [NBP1-92330] - Analysis in control (vector only transfected HEK293T lysate) and RHBDD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: RHBDD2 Antibody [NBP1-92330]

Immunocytochemistry/ Immunofluorescence: RHBDD2 Antibody [NBP1-92330]

Immunocytochemistry/Immunofluorescence: RHBDD2 Antibody [NBP1-92330] - Staining of human cell line U-251 MG shows positivity in golgi apparatus.
RHBDD2 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: RHBDD2 Antibody - BSA Free [NBP1-92330]

Immunocytochemistry/ Immunofluorescence: RHBDD2 Antibody - BSA Free [NBP1-92330]

Staining of human cell line U-251 MG shows localization to the Golgi apparatus.
RHBDD2 Antibody - BSA Free Western Blot: RHBDD2 Antibody - BSA Free [NBP1-92330]

Western Blot: RHBDD2 Antibody - BSA Free [NBP1-92330]

Analysis in control (vector only transfected HEK293T lysate) and RHBDD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for RHBDD2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RHBDD2

Alternate Names

H_RG122E10.2a, H_RG122E10.2b, rhomboid domain containing 2, rhomboid domain-containing protein 2, rhomboid, veinlet-like 7, veinlet-like 7 (Drosophila)

Gene Symbol

RHBDD2

Additional RHBDD2 Products

Product Documents for RHBDD2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RHBDD2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RHBDD2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RHBDD2 Antibody - BSA Free and earn rewards!

Have you used RHBDD2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies