RNF149 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP2-93343

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 221-400 of human RNF149 (NP_775918.2). FYYIQRFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGEPGDVQEMPAPESPPGRDPAANLSLALPDDDGSDDSSPPSASPAESEPQCDPSFKGDAGENTALLEAGRSDSRHGGPIS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RNF149 Antibody - Azide and BSA Free

RNF149 Antibody - Azide and BSA Free

Western Blot: RNF149 Antibody - Azide and BSA Free [NBP2-93343] -

Western Blot: RNF149 Antibody - Azide and BSA Free [NBP2-93343] - Western blot analysis of lysates from Mouse stomach using RNF149 Rabbit pAb at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
RNF149 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: RNF149 Antibody - Azide and BSA Free [NBP2-93343] -

Immunocytochemistry/ Immunofluorescence: RNF149 Antibody - Azide and BSA Free [NBP2-93343] - Immunofluorescence analysis of NIH/3T3 cells using RNF149 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
RNF149 Antibody - Azide and BSA Free

Western Blot: RNF149 Antibody - Azide and BSA Free [NBP2-93343] -

RNF149 downregulates IRF3 protein level through the proteasome pathway.(A) HEK293T cells were transfected with Flag-IRF3 and a gradient concentration of Myc-RNF149 plasmids for 48 h, and the expression of exogenous IRF3 was detected by Western blot. (B) The expression of endogenous IRF3 protein level in HEK293T cells transfected with a gradient concentration of Myc-RNF149 plasmid for 48 h. (C) HEK293T cells were transfected with shRNF149 and Flag-IRF3 plasmids for 48 h, and the expression of exogenous IRF3 was determined by Western blot. (D) The expression of endogenous IRF3 protein level in HEK293T cells transfected with shRNF149 plasmids for 48 h. (E) The expression of IRF3 in peritoneal macrophages from WT and Rnf149−/− mice was detected by Western blot. (F) HEK293T cells were transfected with vector or Myc-RNF149 plasmid for 48 h, and IRF3 mRNA was detected by RT-qPCR. n=3. Expression levels were normalized to 18S mRNA expression and then to the vector sample. (G) HEK293T cells transfected with Myc-RNF149 and Flag-IRF3 plasmids for 36 h were treated with CHX at different time points, and the protein expression of exogenous IRF3 was determined by Western blot. (H-I) HEK293T cells transfected with Myc-RNF149 and Flag-IRF3 plasmids for 36 h were treated with proteasome inhibitor MG132 or lysosome inhibitor CQ for 12 h, and the protein expression of exogenous IRF3 was determined by Western blot. (F) The P-value was determined using an unpaired t-test. ns, not significant. Data are representative of three independent experiments. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40245000), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
RNF149 Antibody - Azide and BSA Free

Western Blot: RNF149 Antibody - Azide and BSA Free [NBP2-93343] -

RNF149 downregulates IRF3 protein level through the proteasome pathway.(A) HEK293T cells were transfected with Flag-IRF3 and a gradient concentration of Myc-RNF149 plasmids for 48 h, and the expression of exogenous IRF3 was detected by Western blot. (B) The expression of endogenous IRF3 protein level in HEK293T cells transfected with a gradient concentration of Myc-RNF149 plasmid for 48 h. (C) HEK293T cells were transfected with shRNF149 and Flag-IRF3 plasmids for 48 h, and the expression of exogenous IRF3 was determined by Western blot. (D) The expression of endogenous IRF3 protein level in HEK293T cells transfected with shRNF149 plasmids for 48 h. (E) The expression of IRF3 in peritoneal macrophages from WT and Rnf149−/− mice was detected by Western blot. (F) HEK293T cells were transfected with vector or Myc-RNF149 plasmid for 48 h, and IRF3 mRNA was detected by RT-qPCR. n=3. Expression levels were normalized to 18S mRNA expression and then to the vector sample. (G) HEK293T cells transfected with Myc-RNF149 and Flag-IRF3 plasmids for 36 h were treated with CHX at different time points, and the protein expression of exogenous IRF3 was determined by Western blot. (H-I) HEK293T cells transfected with Myc-RNF149 and Flag-IRF3 plasmids for 36 h were treated with proteasome inhibitor MG132 or lysosome inhibitor CQ for 12 h, and the protein expression of exogenous IRF3 was determined by Western blot. (F) The P-value was determined using an unpaired t-test. ns, not significant. Data are representative of three independent experiments. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40245000), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for RNF149 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Immunohistochemistry

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RNF149

Alternate Names

DNA polymerase-transactivated protein 2, DNAPTP2, E3 ubiquitin-protein ligase RNF149, EC 6.3.2.-, ring finger protein 149FLJ90504

Gene Symbol

RNF149

Additional RNF149 Products

Product Documents for RNF149 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RNF149 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for RNF149 Antibody - Azide and BSA Free

Customer Reviews for RNF149 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review RNF149 Antibody - Azide and BSA Free and earn rewards!

Have you used RNF149 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...