RNF149 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP2-93343
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 221-400 of human RNF149 (NP_775918.2). FYYIQRFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGEPGDVQEMPAPESPPGRDPAANLSLALPDDDGSDDSSPPSASPAESEPQCDPSFKGDAGENTALLEAGRSDSRHGGPIS
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for RNF149 Antibody - Azide and BSA Free
Western Blot: RNF149 Antibody - Azide and BSA Free [NBP2-93343] -
Western Blot: RNF149 Antibody - Azide and BSA Free [NBP2-93343] - Western blot analysis of lysates from Mouse stomach using RNF149 Rabbit pAb at 1:600 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: RNF149 Antibody - Azide and BSA Free [NBP2-93343] -
Immunocytochemistry/ Immunofluorescence: RNF149 Antibody - Azide and BSA Free [NBP2-93343] - Immunofluorescence analysis of NIH/3T3 cells using RNF149 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Western Blot: RNF149 Antibody - Azide and BSA Free [NBP2-93343] -
RNF149 downregulates IRF3 protein level through the proteasome pathway.(A) HEK293T cells were transfected with Flag-IRF3 and a gradient concentration of Myc-RNF149 plasmids for 48 h, and the expression of exogenous IRF3 was detected by Western blot. (B) The expression of endogenous IRF3 protein level in HEK293T cells transfected with a gradient concentration of Myc-RNF149 plasmid for 48 h. (C) HEK293T cells were transfected with shRNF149 and Flag-IRF3 plasmids for 48 h, and the expression of exogenous IRF3 was determined by Western blot. (D) The expression of endogenous IRF3 protein level in HEK293T cells transfected with shRNF149 plasmids for 48 h. (E) The expression of IRF3 in peritoneal macrophages from WT and Rnf149−/− mice was detected by Western blot. (F) HEK293T cells were transfected with vector or Myc-RNF149 plasmid for 48 h, and IRF3 mRNA was detected by RT-qPCR. n=3. Expression levels were normalized to 18S mRNA expression and then to the vector sample. (G) HEK293T cells transfected with Myc-RNF149 and Flag-IRF3 plasmids for 36 h were treated with CHX at different time points, and the protein expression of exogenous IRF3 was determined by Western blot. (H-I) HEK293T cells transfected with Myc-RNF149 and Flag-IRF3 plasmids for 36 h were treated with proteasome inhibitor MG132 or lysosome inhibitor CQ for 12 h, and the protein expression of exogenous IRF3 was determined by Western blot. (F) The P-value was determined using an unpaired t-test. ns, not significant. Data are representative of three independent experiments. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40245000), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: RNF149 Antibody - Azide and BSA Free [NBP2-93343] -
RNF149 downregulates IRF3 protein level through the proteasome pathway.(A) HEK293T cells were transfected with Flag-IRF3 and a gradient concentration of Myc-RNF149 plasmids for 48 h, and the expression of exogenous IRF3 was detected by Western blot. (B) The expression of endogenous IRF3 protein level in HEK293T cells transfected with a gradient concentration of Myc-RNF149 plasmid for 48 h. (C) HEK293T cells were transfected with shRNF149 and Flag-IRF3 plasmids for 48 h, and the expression of exogenous IRF3 was determined by Western blot. (D) The expression of endogenous IRF3 protein level in HEK293T cells transfected with shRNF149 plasmids for 48 h. (E) The expression of IRF3 in peritoneal macrophages from WT and Rnf149−/− mice was detected by Western blot. (F) HEK293T cells were transfected with vector or Myc-RNF149 plasmid for 48 h, and IRF3 mRNA was detected by RT-qPCR. n=3. Expression levels were normalized to 18S mRNA expression and then to the vector sample. (G) HEK293T cells transfected with Myc-RNF149 and Flag-IRF3 plasmids for 36 h were treated with CHX at different time points, and the protein expression of exogenous IRF3 was determined by Western blot. (H-I) HEK293T cells transfected with Myc-RNF149 and Flag-IRF3 plasmids for 36 h were treated with proteasome inhibitor MG132 or lysosome inhibitor CQ for 12 h, and the protein expression of exogenous IRF3 was determined by Western blot. (F) The P-value was determined using an unpaired t-test. ns, not significant. Data are representative of three independent experiments. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/40245000), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for RNF149 Antibody - Azide and BSA Free
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Immunocytochemistry/ Immunofluorescence
1:50-1:200
Immunohistochemistry
1:50-1:200
Western Blot
1:500-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: RNF149
Alternate Names
DNA polymerase-transactivated protein 2, DNAPTP2, E3 ubiquitin-protein ligase RNF149, EC 6.3.2.-, ring finger protein 149FLJ90504
Gene Symbol
RNF149
Additional RNF149 Products
Product Documents for RNF149 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for RNF149 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCitations for RNF149 Antibody - Azide and BSA Free
Customer Reviews for RNF149 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review RNF149 Antibody - Azide and BSA Free and earn rewards!
Have you used RNF149 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...