RPS5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49198

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RPS5 Antibody - BSA Free

Western Blot: RPS5 Antibody [NBP2-49198]

Western Blot: RPS5 Antibody [NBP2-49198]

Western Blot: RPS5 Antibody [NBP2-49198] - Analysis using Anti-RPS5 antibody NBP2-49198 (A) shows similar pattern to independent antibody NBP2-56843 (B).
Immunocytochemistry/ Immunofluorescence: RPS5 Antibody [NBP2-49198]

Immunocytochemistry/ Immunofluorescence: RPS5 Antibody [NBP2-49198]

Immunocytochemistry/Immunofluorescence: RPS5 Antibody [NBP2-49198] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & endoplasmic reticulum.
Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198]

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198]

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198] - Staining of human colon.
Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198]

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198]

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198]

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198]

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198] - Staining of human cerebral cortex, colon, kidney and lymph node using Anti-RPS5 antibody NBP2-49198 (A) shows similar protein distribution across tissues to independent antibody NBP2-56843 (B).
Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198]

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198]

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198] - Staining of human lymph node.
Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198]

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198]

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198]

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198]

Immunohistochemistry-Paraffin: RPS5 Antibody [NBP2-49198] - Staining of human kidney.

Applications for RPS5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPS5

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7P family of ribosomal proteins. It is located in the cytoplasm. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Alternate Names

ribosomal protein S5,40S ribosomal protein S5

Gene Symbol

RPS5

Additional RPS5 Products

Product Documents for RPS5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPS5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPS5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPS5 Antibody - BSA Free and earn rewards!

Have you used RPS5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...