RPS8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35828

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human RPS8 (NP_001003.1).

Sequence:
KRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RPS8 Antibody - BSA Free

RPS8 Antibody

Western Blot: RPS8 Antibody [NBP3-35828] -

Western Blot: RPS8 Antibody [NBP3-35828] - Western blot analysis of various lysates using RPS8 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
RPS8 Antibody

Immunocytochemistry/ Immunofluorescence: RPS8 Antibody [NBP3-35828] -

Immunocytochemistry/ Immunofluorescence: RPS8 Antibody [NBP3-35828] - Immunofluorescence analysis of L929 cells using RPS8 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.
RPS8 Antibody

Immunocytochemistry/ Immunofluorescence: RPS8 Antibody [NBP3-35828] -

Immunocytochemistry/ Immunofluorescence: RPS8 Antibody [NBP3-35828] - Immunofluorescence analysis of C6 cells using RPS8 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for RPS8 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RPS8

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S8E family of ribosomal proteins. It is located in the cytoplasm. Increased expression of this gene in colorectal tumors and colon polyps compared to matched normal colonic mucosa has been observed. This gene is co-transcribed with the small nucleolar RNA genes U38A, U38B, U39, and U40, which are located in its fourth, fifth, first, and second introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Alternate Names

OK/SW-cl.83, ribosomal protein S8,40S ribosomal protein S8

Gene Symbol

RPS8

Additional RPS8 Products

Product Documents for RPS8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RPS8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RPS8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RPS8 Antibody - BSA Free and earn rewards!

Have you used RPS8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...