RSF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57248

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all RSF1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGSMQKSKFKYKLVPEEETTASENTEITSERQKEGIKLTIRI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for RSF1 Antibody - BSA Free

Western Blot: RSF1 Antibody [NBP2-57248]

Western Blot: RSF1 Antibody [NBP2-57248]

Western Blot: RSF1 Antibody [NBP2-57248] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: RSF1 Antibody [NBP2-57248]

Immunocytochemistry/ Immunofluorescence: RSF1 Antibody [NBP2-57248]

Immunocytochemistry/Immunofluorescence: RSF1 Antibody [NBP2-57248] - Staining of human cell line CACO-2 shows localization to nucleoplasm.

Applications for RSF1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RSF1

HBXAP is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H (MIM 603375).[supplied by OMIM]

Alternate Names

HBV pX associated protein-8, HBXAPp325 subunit of RSF chromatin-remodeling complex, hepatitis B virus x associated protein, Hepatitis B virus X-associated protein, p325, remodeling and spacing factor 1, Rsf-1, XAP8HBV pX-associated protein 8

Gene Symbol

RSF1

Additional RSF1 Products

Product Documents for RSF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RSF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RSF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RSF1 Antibody - BSA Free and earn rewards!

Have you used RSF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies