RUNX1T1/ETO Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09370

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all RUNX1T1/ETO Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide directed towards the middle region of human RUNX1T1/ETO. Peptide sequence: CGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTP.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RUNX1T1/ETO Antibody - BSA Free

Immunohistochemistry-Paraffin: RUNX1T1/ETO Antibody [NBP3-09370]

Immunohistochemistry-Paraffin: RUNX1T1/ETO Antibody [NBP3-09370]

Immunohistochemistry-Paraffin: RUNX1T1/ETO Antibody [NBP3-09370] - Immunohistochemical analysis of formalin-fixed paraffin-embedded hepatocyte nuclei in human liver tissue using NBP3-09370 at a dilution of 1:100. Donkey anti-Rabbit-Cy3 used as a secondary antibody at a dilution of 1:200. 20X magnification.

Applications for RUNX1T1/ETO Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RUNX1T1/ETO

RUNX1T1 / ETO is encoded by this gene is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Several transcript variants encoding multiple isoforms have been found for this gene.

Alternate Names

AML1T1protein CBFA2T1, CBFA2T1Cyclin-D-related protein, CDRMGC2796, core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related, DKFZp564B213, Eight twenty one protein, ETOFLJ33145, MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related, Protein ETO, Protein MTG8, runt-related transcription factor 1; translocated to, 1 (cyclin D-related), Zinc finger MYND domain-containing protein 2, ZMYND2myeloid translocation gene on 8q22

Gene Symbol

RUNX1T1

Additional RUNX1T1/ETO Products

Product Documents for RUNX1T1/ETO Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for RUNX1T1/ETO Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RUNX1T1/ETO Antibody - BSA Free

There are currently no reviews for this product. Be the first to review RUNX1T1/ETO Antibody - BSA Free and earn rewards!

Have you used RUNX1T1/ETO Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies