RXR alpha/NR2B1 Antibody (6Y10M1)

Novus Biologicals | Catalog # NBP3-15667

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chromatin Immunoprecipitation (ChIP), Chromatin Immunoprecipitation Sequencing

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6Y10M1 expressed in HEK293
View all RXR alpha/NR2B1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RXR alpha/NR2B1 (P19793). MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for RXR alpha/NR2B1 Antibody (6Y10M1)

Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667]

Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667]

Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Western blot analysis of extracts of various cell lines, using RXR alpha/NR2B1 antibody (NBP3-15667) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.
Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667]

Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667]

Western Blot: RXR alpha/NR2B1 Antibody (6Y10M1) [NBP3-15667] - Western blot analysis of extracts of various cell lines, using RXR alpha/NR2B1 antibody (NBP3-15667) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
RXR alpha/NR2B1 Antibody (6Y10M1)

Immunocytochemistry/ Immunofluorescence: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] -

Immunocytochemistry/ Immunofluorescence: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Confocal imaging of HeLa cells using RXR alpha/NR2B1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
RXR alpha/NR2B1 Antibody (6Y10M1)

Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] -

Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR alpha/NR2B1 Rabbit mAb. DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2. The ChIP sequencing results indicate the enrichment pattern of RXR alpha/NR2B1 across chromosome 19 (upper panel) and the genomic region encompassing ECH1, a representative gene enriched in RXR alpha/NR2B1 (lower panel).
RXR alpha/NR2B1 Antibody (6Y10M1)

Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] -

Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation was performed with 25 ug of cross-linked chromatin from HepG2 cells using 5 ug of RXR alpha/NR2B1 Rabbit mAb. DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2. The ChIP sequencing results indicate the enrichment pattern of RXR alpha/NR2B1 in the representative genomic region surrounding ECH1 gene.
RXR alpha/NR2B1 Antibody (6Y10M1)

Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] -

Chromatin Immunoprecipitation: RXR alpha/NR2B1 Antibody (6Y10M1) [RXR alpha/NR2B1] - Chromatin immunoprecipitation analysis of extracts from HepG2 cells, using RXR alpha/NR2B1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Applications for RXR alpha/NR2B1 Antibody (6Y10M1)

Application
Recommended Usage

Chromatin Immunoprecipitation (ChIP)

5μg antibody for 10μg-15μg of Chromatin

Chromatin Immunoprecipitation Sequencing

1:50 - 1:100

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:1000

Immunoprecipitation

0.5μg-4μg antibody for 200μg-400μg extracts of whole cells

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RXR alpha/NR2B1

The steroid receptor superfamily acts through direct association with DNA sequences known as hormone response elements (HREs) and bind DNA as either homo- or heterodimers. The promiscuous mediator of heterodimerization, RXR, is the receptor for 9-cis reti

Long Name

Retinoid X Receptor, alpha

Alternate Names

NR2B1, RXRA

Gene Symbol

RXRA

Additional RXR alpha/NR2B1 Products

Product Documents for RXR alpha/NR2B1 Antibody (6Y10M1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for RXR alpha/NR2B1 Antibody (6Y10M1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for RXR alpha/NR2B1 Antibody (6Y10M1)

There are currently no reviews for this product. Be the first to review RXR alpha/NR2B1 Antibody (6Y10M1) and earn rewards!

Have you used RXR alpha/NR2B1 Antibody (6Y10M1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies