SALL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13275

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: TLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPESATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SALL1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SALL1 Antibody [NBP2-13275]

Immunocytochemistry/ Immunofluorescence: SALL1 Antibody [NBP2-13275]

Immunocytochemistry/Immunofluorescence: SALL1 Antibody [NBP2-13275] - Staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
SALL1 Antibody - BSA Free Immunohistochemistry: SALL1 Antibody - BSA Free [NBP2-13275]

Immunohistochemistry: SALL1 Antibody - BSA Free [NBP2-13275]

Staining of human cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.
SALL1 Antibody - BSA Free Immunohistochemistry: SALL1 Antibody - BSA Free [NBP2-13275]

Immunohistochemistry: SALL1 Antibody - BSA Free [NBP2-13275]

Staining of human testis shows moderate nuclear positivity in Leydig cells and cells in seminiferous ducts.
SALL1 Antibody - BSA Free Immunohistochemistry: SALL1 Antibody - BSA Free [NBP2-13275]

Immunohistochemistry: SALL1 Antibody - BSA Free [NBP2-13275]

Staining of human kidney shows moderate nucleus positivity in cells in tubules.
SALL1 Antibody - BSA Free Immunohistochemistry: SALL1 Antibody - BSA Free [NBP2-13275]

Immunohistochemistry: SALL1 Antibody - BSA Free [NBP2-13275]

Staining of human thyroid gland shows strong nuclear positivity in glandular cells.
SALL1 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: SALL1 Antibody - BSA Free [NBP2-13275]

Chromatin Immunoprecipitation-exo-Seq: SALL1 Antibody - BSA Free [NBP2-13275]

ChIP-Exo-Seq composite graph for Anti-SALL1 (NBP2-13275) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for SALL1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SALL1

The protein encoded by the SALL1 gene is a zinc finger transcriptional repressor and may be part of the NuRD histone deacetylase complex (HDAC). Defects in this gene are a cause of Townes-Brocks syndrome (TBS) as well as bronchio-oto-renal syndrome (BOR). Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Long Name

Sal-like 1

Alternate Names

HSal1, sal (Drosophila)-like 1, SAL1, Sal-1, sal-like 1 (Drosophila), sal-like protein 1, Spalt-like transcription factor 1, Zinc finger protein 794, Zinc finger protein SALL1, Zinc finger protein Spalt-1, ZNF794TBS

Gene Symbol

SALL1

Additional SALL1 Products

Product Documents for SALL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SALL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for SALL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SALL1 Antibody - BSA Free and earn rewards!

Have you used SALL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...