SAP155 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57192

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SAP155 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SF3B1 (splicing factor 3b, subunit 1, 155kDa) The peptide sequence was selected from the middle region of SF3B1. Peptide sequence LLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADG. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: 1.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SAP155 Antibody - BSA Free

Western Blot: SAP155 Antibody [NBP1-57192]

Western Blot: SAP155 Antibody [NBP1-57192]

Western Blot: SAP155 Antibody [NBP1-57192] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry: SAP155 Antibody [NBP1-57192]

Immunohistochemistry: SAP155 Antibody [NBP1-57192]

Immunohistochemistry: SAP155 Antibody [NBP1-57192] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Immunohistochemistry-Paraffin: SAP155 Antibody [NBP1-57192]

Immunohistochemistry-Paraffin: SAP155 Antibody [NBP1-57192]

Immunohistochemistry-Paraffin: SAP155 Antibody [NBP1-57192] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Applications for SAP155 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SAP155

SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.

Alternate Names

Hsh155, pre-mRNA processing 10, pre-mRNA splicing factor SF3b, 155 kDa subunit, Pre-mRNA-splicing factor SF3b 155 kDa subunit, Prp10, PRPF10, SAP 155, SAP155splicing factor 3b, subunit 1, 155kD, SF3B155, SF3b155PRP10, spliceosome associated protein 155, Spliceosome-associated protein 155, splicing factor 3B subunit 1, splicing factor 3b, subunit 1, 155kDa

Gene Symbol

SF3B1

Additional SAP155 Products

Product Documents for SAP155 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SAP155 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SAP155 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SAP155 Antibody - BSA Free and earn rewards!

Have you used SAP155 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies