SAP30BP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10320

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all SAP30BP Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SAP30BP (NP_037392). Peptide sequence AEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SAP30BP Antibody - BSA Free

Immunohistochemistry-Paraffin: SAP30BP Antibody [NBP3-10320]

Immunohistochemistry-Paraffin: SAP30BP Antibody [NBP3-10320]

Immunohistochemistry-Paraffin: SAP30BP Antibody [NBP3-10320] - Immunohistochemical analysis of paraffin-embedded human heart cell tissue.

Applications for SAP30BP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SAP30BP

SAP30BP, also known as SAP30-binding protein, has a 308 amino acid long isoform that is 34 kDa and a short 292 amino acid isoform that is 32 kDa; is involved in the regulation of beta-2-microglobulin genes and also plays a role of a transcriptional co-repressor of a gene related to cell survival. Studies on this protein have shown its involvement with obesity and schizophrenia. This protein has been shown to have interactions with PUF60, SF3A2, MLX, SAP30, FHL2, ZNF212, ZNF408, and MEPCE protein in transcription, DNA-dependent; regulation of transcription DNA-dependent, apoptotic process, and induction of apoptosis pathways.

Alternate Names

HCNGPDKFZp586L2022, HTRGHSV-1 binding, HTRPSAP30-binding protein, SAP30 binding protein, Transcriptional regulator protein HCNGP

Gene Symbol

SAP30BP

Additional SAP30BP Products

Product Documents for SAP30BP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SAP30BP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SAP30BP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SAP30BP Antibody - BSA Free and earn rewards!

Have you used SAP30BP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies