SCEL Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82137

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KVTPEVKRSNQGSKDLNNFIKVYPGTEKSTEGGQSLDSLIKVTPERNRTNQGNQDLENLIKVIPSANKSSEQGLDE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SCEL Antibody - BSA Free

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining in human esophagus and liver tissues using NBP1-82137 antibody. Corresponding SCEL RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining of human liver, skin, testis and tonsil using Anti-SCEL antibody NBP1-82137 (A) shows similar protein distribution across tissues to independent antibody NBP1-82138 (B).
Western Blot: SCEL Antibody [NBP1-82137]

Western Blot: SCEL Antibody [NBP1-82137]

Western Blot: SCEL Antibody [NBP1-82137] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining of human esophagus shows strong membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining of human skin shows moderate to strong cytoplasmic and membranous positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137]

Immunohistochemistry-Paraffin: SCEL Antibody [NBP1-82137] - Staining of human tonsil shows strong cytoplasmic and membranous positivity in squamous epithelial cells.

Applications for SCEL Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SCEL

SCEL is encoded by this gene is a precursor to the cornified envelope of terminally differentiated keratinocytes. This protein localizes to the periphery of cells and may function in the assembly or regulation of proteins in the cornified envelope. Transcript variants encoding different isoforms exist. A transcript variant utilizing an alternative polyA signal has been described in the literature, but its full-length nature has not been determined. [provided by RefSeq]

Alternate Names

FLJ21667, MGC22531, sciellin

Gene Symbol

SCEL

Additional SCEL Products

Product Documents for SCEL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SCEL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCEL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SCEL Antibody - BSA Free and earn rewards!

Have you used SCEL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...