SCRT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92369

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LHDKGYLSDYVGPSSVYDGDAEAALLKGPSPEPMYAAAVRGELGP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SCRT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: SCRT1 Antibody [NBP1-92369]

Immunohistochemistry-Paraffin: SCRT1 Antibody [NBP1-92369]

Immunohistochemistry-Paraffin: SCRT1 Antibody [NBP1-92369] - Analysis in human cerebral cortex and skeletal muscle tissues using HPA045265 antibody. Corresponding SCRT1 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: SCRT1 Antibody [NBP1-92369]

Immunocytochemistry/ Immunofluorescence: SCRT1 Antibody [NBP1-92369]

Immunocytochemistry/Immunofluorescence: SCRT1 Antibody [NBP1-92369] - Staining of human cell line SH-SY5Y shows localization to nuclear bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SCRT1 Antibody [NBP1-92369]

Immunohistochemistry-Paraffin: SCRT1 Antibody [NBP1-92369]

Immunohistochemistry-Paraffin: SCRT1 Antibody [NBP1-92369] - Staining of mouse eye, retina shows moderate positivity.
Immunohistochemistry-Paraffin: SCRT1 Antibody [NBP1-92369]

Immunohistochemistry-Paraffin: SCRT1 Antibody [NBP1-92369]

Immunohistochemistry-Paraffin: SCRT1 Antibody [NBP1-92369] - Staining of mouse brain shnows moderate to strong nuclear positivity in neurons.
SCRT1 Antibody - BSA Free Immunohistochemistry: SCRT1 Antibody - BSA Free [NBP1-92369]

Immunohistochemistry: SCRT1 Antibody - BSA Free [NBP1-92369]

Staining of human cerebellum shows moderate to strong nuclear positivity in cells in molecular layer.
SCRT1 Antibody - BSA Free Immunohistochemistry: SCRT1 Antibody - BSA Free [NBP1-92369]

Immunohistochemistry: SCRT1 Antibody - BSA Free [NBP1-92369]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
SCRT1 Antibody - BSA Free Immunohistochemistry: SCRT1 Antibody - BSA Free [NBP1-92369]

Immunohistochemistry: SCRT1 Antibody - BSA Free [NBP1-92369]

Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
SCRT1 Antibody - BSA Free Immunohistochemistry: SCRT1 Antibody - BSA Free [NBP1-92369]

Immunohistochemistry: SCRT1 Antibody - BSA Free [NBP1-92369]

Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-92369 antibody. Corresponding SCRT1 RNA-seq data are presented for the same tissues.

Applications for SCRT1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SCRT1

The SCRT1 gene is a member of the Snail family of C2H2-type zinc finger transcription factors. It codes for aneural-specific transcriptional repressor that binds to E-box motifs. The protein may promote neural differention andmay be involved in cancers with ne

Alternate Names

scratch homolog 1, zinc finger protein (Drosophila)

Gene Symbol

SCRT1

Additional SCRT1 Products

Product Documents for SCRT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SCRT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SCRT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SCRT1 Antibody - BSA Free and earn rewards!

Have you used SCRT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...