SDHC Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37905

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SDHC Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SDHC (NP_002992.1).

Sequence:
MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SDHC Antibody - BSA Free

SDHC Antibody

Western Blot: SDHC Antibody [NBP3-37905] -

Western Blot: SDHC Antibody [NBP3-37905] - Western blot analysis of various lysates using SDHC Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
SDHC Antibody

Immunohistochemistry: SDHC Antibody [NBP3-37905] -

Immunohistochemistry: SDHC Antibody [NBP3-37905] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using SDHC Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
SDHC Antibody

Immunocytochemistry/ Immunofluorescence: SDHC Antibody [NBP3-37905] -

Immunocytochemistry/ Immunofluorescence: SDHC Antibody [NBP3-37905] - Immunofluorescence analysis of A-431 cells using SDHC Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SDHC Antibody

Immunocytochemistry/ Immunofluorescence: SDHC Antibody [NBP3-37905] -

Immunocytochemistry/ Immunofluorescence: SDHC Antibody [NBP3-37905] - Immunofluorescence analysis of HeLa cells using SDHC Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SDHC Antibody

Immunocytochemistry/ Immunofluorescence: SDHC Antibody [NBP3-37905] -

Immunocytochemistry/ Immunofluorescence: SDHC Antibody [NBP3-37905] - Immunofluorescence analysis of NIH/3T3 cells using SDHC Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for SDHC Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SDHC

SDHC encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. Several related pseudogenes are located in different genomic regions. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

Integral membrane protein CII-3, mitochondrial, PGL3, QPs1, QPs-1, SDH3, succinate dehydrogenase complex, subunit C, integral membrane protein, 15kD, succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa, succinate-ubiquinone oxidoreducatase cytochrome B large subunit

Gene Symbol

SDHC

Additional SDHC Products

Product Documents for SDHC Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SDHC Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SDHC Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SDHC Antibody - BSA Free and earn rewards!

Have you used SDHC Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies